Gene [FLAX] | FIBexDB

Lus10038719 [FLAX]

External link

Symbol

Arabidopsis homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	TF class	Alias	TAIR10 short description
AT5G24090	93 / 5e-24		ATCHIA	chitinase A (.1)

Paralogs

Show only best Show top 10

Gene ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Lus10037984 [exp]	148 / 4e-44	AT5G24090	322 / 1e-108	chitinase A (.1)
Lus10040419 [exp]	106 / 4e-29	AT5G24090	362 / 3e-126	chitinase A (.1)
Lus10009216 [exp]	101 / 4e-27	AT5G24090	360 / 1e-125	chitinase A (.1)
Lus10037985 [exp]	100 / 4e-27	AT5G24090	357 / 2e-124	chitinase A (.1)
Lus10009215 [exp]	100 / 6e-27	AT5G24090	371 / 6e-130	chitinase A (.1)
Lus10001868 [exp]	99 / 2e-26	AT5G24090	332 / 1e-114	chitinase A (.1)
Lus10027560 [exp]	96 / 6e-26	AT5G24090	295 / 4e-101	chitinase A (.1)
Lus10039317 [exp]	96 / 8e-26	AT5G24090	300 / 2e-103	chitinase A (.1)
Lus10023535 [exp]	96 / 4e-25	AT5G24090	363 / 7e-127	chitinase A (.1)

Poplar homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Potri.002G242000 [exp]	100 / 6e-27	AT5G24090	387 / 3e-136	chitinase A (.1)
Potri.002G165700 [exp]	100 / 1e-26	AT5G24090	396 / 9e-140	chitinase A (.1)
Potri.014G091600 [exp]	99 / 3e-26	AT5G24090	362 / 3e-126	chitinase A (.1)
Potri.014G091700 [exp]	99 / 3e-26	AT5G24090	340 / 1e-117	chitinase A (.1)
Potri.015G024200 [exp]	93 / 4e-24	AT5G24090	407 / 4e-144	chitinase A (.1)
Potri.015G024100 [exp]	82 / 3e-20	AT5G24090	336 / 4e-116	chitinase A (.1)
Potri.015G024000 [exp]	82 / 3e-20	AT5G24090	337 / 2e-116	chitinase A (.1)
Potri.012G033866 [exp]	82 / 6e-20	AT5G24090	352 / 3e-122	chitinase A (.1)
Potri.015G024150 [exp]	79 / 5e-19	AT5G24090	329 / 3e-113	chitinase A (.1)
Potri.015G023900 [exp]	79 / 5e-19	AT5G24090	329 / 3e-113	chitinase A (.1)

PFAM info

Representative CDS sequence

Show only first row Show all

>Lus10038719 pacid=23143054 polypeptide=Lus10038719 locus=Lus10038719.g ID=Lus10038719.BGIv1.0 annot-version=v1.0

ATGGGATACCCTGGCGCGAAGCCTGAAGTCGTATACGGGGGTTCTATTGACGGCAGCTCCACAGTGCCCGTATCCGGACGTTTCTACAACAATGCCCCTT

GCCAGTATTCCTCTGGGAATCTTGTGACATCGTGGCATCAGTGGGTGTCCAGTGCTTCTGCTACCAAGATCTTTCTGGGTTCGCCTGCTTCCACTGATGC

TGCCGGGACAGGCTTCATCCCTGCGTCGGATCTCATCAACGACGTTCTCCCCAAAATAAAGGGGAGTCATAAGTATGGTGGGGTGATGCTGTGGTCCAAC

TGCTGTGGGATATAG

AA sequence

Show only first row Show all

>Lus10038719 pacid=23143054 polypeptide=Lus10038719 locus=Lus10038719.g ID=Lus10038719.BGIv1.0 annot-version=v1.0

MGYPGAKPEVVYGGSIDGSSTVPVSGRFYNNAPCQYSSGNLVTSWHQWVSSASATKIFLGSPASTDAAGTGFIPASDLINDVLPKIKGSHKYGGVMLWSN

CCGI

DESeq2's median of ratios [FLAX]

Coexpressed genes

Download tab-delimited text

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G24090		ATCHIA	chitinase A (.1)		Lus10038719 [exp]	0	1

Lus10038719 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.