Lus10038737 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G64620 49 / 1e-07 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039120 105 / 9e-29 AT5G64620 69 / 5e-15 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Lus10038738 97 / 1e-25 AT5G64620 67 / 4e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G001600 59 / 4e-11 AT5G64620 82 / 9e-20 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.008G013400 50 / 9e-08 AT5G64620 66 / 8e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.008G102600 45 / 5e-06 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.002G191500 42 / 6e-05 AT2G31430 104 / 2e-28 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.011G114700 39 / 0.0006 AT5G64620 47 / 1e-06 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10038737 pacid=23150375 polypeptide=Lus10038737 locus=Lus10038737.g ID=Lus10038737.BGIv1.0 annot-version=v1.0
ATGTCTTTCCCACTGATCACCATCGTCCTCCTCCTCGCAACCGCCACGTCATCATCGGCGGTGAACTCGACCCCACAGGTACAAAGCTTCTGCAAGAAGA
CATCAATGCCACCGCAATGCGAATTCTCCCTCAGCCTCGACCCGTCCACGTCACGCGCCCGCGACCCCTTCACGCTGGCGTCCATAGCGGTGAGGCTCTC
CTACCTCAACGCCACCGAGACCCAGAACTTCATCGCCGGCCTCCAGAAGAGCGGCGGAGACGGCGGGACGGTCGGGCTGAAGCGGCTGCGCGTGTGCGCG
TCGAGGTACAGCCTGGCGCTTGGGATGGTGGCGAACATGGACGGGGACATCAACGACGACAATTATTCCAACTTGGCATACGAGGCTAGGGAGGCCAAGG
CTTACGTGGACAGGTGCGAGGCTGAATGGACGAAGGCCACGTGGAAGCCTATGGGGATTAGGAATATGGTTTTGGGTGTGCTGTTTGAGGTTATTGCGGC
TATTGGGAATTCTGTCGCCGGTCGTCCTTAG
AA sequence
>Lus10038737 pacid=23150375 polypeptide=Lus10038737 locus=Lus10038737.g ID=Lus10038737.BGIv1.0 annot-version=v1.0
MSFPLITIVLLLATATSSSAVNSTPQVQSFCKKTSMPPQCEFSLSLDPSTSRARDPFTLASIAVRLSYLNATETQNFIAGLQKSGGDGGTVGLKRLRVCA
SRYSLALGMVANMDGDINDDNYSNLAYEAREAKAYVDRCEAEWTKATWKPMGIRNMVLGVLFEVIAAIGNSVAGRP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G64620 ATC/VIF2, C/VIF... cell wall / vacuolar inhibitor... Lus10038737 0 1
AT2G39180 CCR2, ATCRR2 CRINKLY4 related 2 (.1) Lus10041404 13.2 0.8558
AT1G70590 F-box family protein (.1) Lus10004621 21.8 0.8027
AT3G43270 Plant invertase/pectin methyle... Lus10010170 30.5 0.8125
AT1G05870 Protein of unknown function (D... Lus10025562 39.0 0.8051
AT3G61260 Remorin family protein (.1) Lus10017811 52.2 0.7914
AT2G23970 Class I glutamine amidotransfe... Lus10033793 52.6 0.7400
AT4G24510 VC2, VC-2, CER2 ECERIFERUM 2, HXXXD-type acyl-... Lus10028171 54.7 0.8325
AT1G06260 Cysteine proteinases superfami... Lus10039901 57.1 0.8324
AT1G34550 EMB2756 EMBRYO DEFECTIVE 2756, Protein... Lus10009419 58.1 0.7554
AT4G15415 ATB'GAMMA, ATB'... Protein phosphatase 2A regulat... Lus10025085 60.0 0.8193

Lus10038737 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.