Lus10038738 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G64620 58 / 8e-11 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
AT3G17152 52 / 2e-08 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G17150 47 / 1e-06 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G47960 39 / 0.0009 ATC/VIF1, C/VIF1 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039120 248 / 4e-85 AT5G64620 69 / 5e-15 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Lus10038737 91 / 3e-23 AT5G64620 56 / 7e-10 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Lus10027947 54 / 4e-09 AT1G47960 111 / 1e-30 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10000822 47 / 1e-06 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10022409 44 / 2e-05 AT5G64620 155 / 3e-48 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Lus10017345 43 / 3e-05 AT3G17220 89 / 1e-22 pectin methylesterase inhibitor 2 (.1)
Lus10016317 42 / 5e-05 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10001658 41 / 0.0001 AT1G48020 86 / 4e-21 ARABIDOPSIS THALIANA PECTIN METHYLESTERASE INHIBITOR 1, pectin methylesterase inhibitor 1 (.1)
Lus10003530 40 / 0.0003 AT1G47960 91 / 5e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G013400 133 / 1e-39 AT5G64620 66 / 8e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.016G001600 113 / 5e-32 AT5G64620 82 / 9e-20 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.002G191500 54 / 2e-09 AT2G31430 104 / 2e-28 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.008G102600 51 / 2e-08 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.007G108301 49 / 2e-07 AT5G64620 163 / 1e-51 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.004G016500 45 / 6e-06 AT4G02250 73 / 2e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.009G083500 44 / 7e-06 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.010G209800 44 / 8e-06 AT5G64620 93 / 5e-24 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.006G134900 44 / 9e-06 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.002G066300 41 / 0.0001 ND /
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10038738 pacid=23150518 polypeptide=Lus10038738 locus=Lus10038738.g ID=Lus10038738.BGIv1.0 annot-version=v1.0
ATGTCCGCCTCCTTCCTCGTCCCGCTACAACTACTCCTTCTCATCTCAACCGCCGCCATCACCATCGCCGCCACCCCGACGAACCTCGTCCAGCAACTCT
GCAAGAAATCCTCCGCCTACGCGCTGTGCGTGGAGGCGCTGTACGCGGACTCCAGGACGCCGGACGCGGACCGGACCACCATGGCGTTCATCTCCGTCGG
GCTGGCCTACCAGAACGCCACCGGGACTCGCTCCTACATCTCCAGCCTCCTTCGCGGCCGGGCCGGGCGGGAGCGGCTCAGCAGATGCGGATCGGACTAC
GACGTCGCGATCAACAAGATGGAGCGGGCCTCCAACGACTTGAATTCGGAGACGTACTACGGCCTGGCTGAGCTGGCAAAGGGAGCCGCCGACGCTGCCA
AACACTGCCAGGCTGTATTCGCGAAGTCCCCGTGGCGGCCTATGGGGAACCGGAACCGGGTGTTGGCGGTTTTGTGTGAGGTTATTGGGGTGATTGGGAA
GTCCTTCACCGGCAAAGATTGA
AA sequence
>Lus10038738 pacid=23150518 polypeptide=Lus10038738 locus=Lus10038738.g ID=Lus10038738.BGIv1.0 annot-version=v1.0
MSASFLVPLQLLLLISTAAITIAATPTNLVQQLCKKSSAYALCVEALYADSRTPDADRTTMAFISVGLAYQNATGTRSYISSLLRGRAGRERLSRCGSDY
DVAINKMERASNDLNSETYYGLAELAKGAADAAKHCQAVFAKSPWRPMGNRNRVLAVLCEVIGVIGKSFTGKD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G64620 ATC/VIF2, C/VIF... cell wall / vacuolar inhibitor... Lus10038738 0 1
AT4G20260 ATPCAP1 ARABIDOPSIS THALIANA PLASMA-ME... Lus10038383 1.4 0.9573
AT5G50400 ATPAP27, PAP27 ARABIDOPSIS THALIANA PURPLE AC... Lus10039565 2.4 0.9165
AT4G20260 ATPCAP1 ARABIDOPSIS THALIANA PLASMA-ME... Lus10036243 3.2 0.9487
AT4G28530 NAC ANAC074 NAC domain containing protein ... Lus10022915 4.7 0.9047
AT2G39130 Transmembrane amino acid trans... Lus10039190 6.7 0.9160
AT4G24480 Protein kinase superfamily pro... Lus10042868 6.7 0.9063
AT4G32140 EamA-like transporter family (... Lus10041032 8.5 0.9113
AT4G36890 IRX14 irregular xylem 14, Nucleotide... Lus10033785 8.8 0.9014
Lus10011059 9.5 0.9105
AT1G15860 Domain of unknown function (DU... Lus10039198 10.4 0.9033

Lus10038738 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.