Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039115 [exp] 72 / 9e-19 ND / Lus10038768 [exp] 45 / 9e-08 ND / Lus10039096 [exp] 47 / 1e-07 AT3G13290 131 / 2e-33 varicose-related (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10038743 pacid=23150434 polypeptide=Lus10038743 locus=Lus10038743.g ID=Lus10038743.BGIv1.0 annot-version=v1.0 ATGGTCACCATTGCCATTTCTGCTGATGCAGCCCGAGTCGTACGTGCAGCAGATGCCCCTGGTGCTACCTCTTTTACCCCCCAGCAGAGTTTCAAAGATG TTGTTCTTCACCCAGAAGCAGGCTGCCGCTGCTGCTATTACGTAAAGAACTCATCTGGACTCTATGTCTGTGGCTATGTTTGCTGTGTTGATGGCTGTTG CTGA
AA sequence Show only first row Show all	>Lus10038743 pacid=23150434 polypeptide=Lus10038743 locus=Lus10038743.g ID=Lus10038743.BGIv1.0 annot-version=v1.0 MVTIAISADAARVVRAADAPGATSFTPQQSFKDVVLHPEAGCRCCYYVKNSSGLYVCGYVCCVDGCC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10038743 [exp]	0	1
AT5G64440		ATFAAH	fatty acid amide hydrolase (.1...		Lus10035974 [exp]	1.0	0.9993
AT1G78980		SRF5	STRUBBELIG-receptor family 5 (...		Lus10034790 [exp]	2.0	0.9945
AT3G19550			unknown protein		Lus10002114 [exp]	3.5	0.9907
AT3G19550			unknown protein		Lus10002115 [exp]	3.9	0.9882
AT3G19550			unknown protein		Lus10013900 [exp]	4.1	0.9387
AT3G19550			unknown protein		Lus10013901 [exp]	4.5	0.9894
AT5G46090			Protein of unknown function (D...		Lus10018635 [exp]	4.6	0.9774
					Lus10033284 [exp]	4.7	0.9530
AT1G73110			P-loop containing nucleoside t...		Lus10024092 [exp]	6.0	0.9629
AT1G50380			Prolyl oligopeptidase family p...		Lus10032964 [exp]	6.9	0.9823

Compare expression of checked genes

Lus10038743 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.