Lus10038765 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G16760 350 / 5e-121 AtITPK1 inositol \(1,3,4\) P3 5/6-kinase 1, Arabidopsis thaliana inositol \(1,3,4\) P3 5/6-kinase 1, Inositol 1,3,4-trisphosphate 5/6-kinase family protein (.1)
AT4G08170 249 / 7e-81 Inositol 1,3,4-trisphosphate 5/6-kinase family protein (.1.2.3)
AT4G33770 225 / 4e-71 Inositol 1,3,4-trisphosphate 5/6-kinase family protein (.1.2)
AT2G43980 82 / 5e-17 ATITPK4 "inositol 1,3,4-trisphosphate 5/6-kinase 4", inositol 1,3,4-trisphosphate 5/6-kinase 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039098 622 / 0 AT5G55990 374 / 1e-128 calcineurin B-like protein 2 (.1)
Lus10035811 387 / 8e-136 AT5G16760 311 / 1e-105 inositol \(1,3,4\) P3 5/6-kinase 1, Arabidopsis thaliana inositol \(1,3,4\) P3 5/6-kinase 1, Inositol 1,3,4-trisphosphate 5/6-kinase family protein (.1)
Lus10035662 248 / 1e-80 AT4G08170 455 / 2e-161 Inositol 1,3,4-trisphosphate 5/6-kinase family protein (.1.2.3)
Lus10032808 236 / 7e-76 AT4G08170 500 / 5e-179 Inositol 1,3,4-trisphosphate 5/6-kinase family protein (.1.2.3)
Lus10007689 230 / 3e-73 AT4G08170 499 / 2e-178 Inositol 1,3,4-trisphosphate 5/6-kinase family protein (.1.2.3)
Lus10037247 181 / 2e-55 AT4G08170 345 / 3e-119 Inositol 1,3,4-trisphosphate 5/6-kinase family protein (.1.2.3)
Lus10020513 159 / 9e-47 AT4G08170 331 / 2e-113 Inositol 1,3,4-trisphosphate 5/6-kinase family protein (.1.2.3)
Lus10033768 76 / 4e-15 AT2G43980 395 / 4e-135 "inositol 1,3,4-trisphosphate 5/6-kinase 4", inositol 1,3,4-trisphosphate 5/6-kinase 4 (.1)
Lus10006145 75 / 5e-15 AT2G43980 317 / 1e-105 "inositol 1,3,4-trisphosphate 5/6-kinase 4", inositol 1,3,4-trisphosphate 5/6-kinase 4 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G047200 372 / 1e-129 AT5G16760 332 / 1e-113 inositol \(1,3,4\) P3 5/6-kinase 1, Arabidopsis thaliana inositol \(1,3,4\) P3 5/6-kinase 1, Inositol 1,3,4-trisphosphate 5/6-kinase family protein (.1)
Potri.001G140000 332 / 2e-113 AT5G16760 372 / 6e-129 inositol \(1,3,4\) P3 5/6-kinase 1, Arabidopsis thaliana inositol \(1,3,4\) P3 5/6-kinase 1, Inositol 1,3,4-trisphosphate 5/6-kinase family protein (.1)
Potri.003G094100 331 / 5e-113 AT5G16760 373 / 2e-129 inositol \(1,3,4\) P3 5/6-kinase 1, Arabidopsis thaliana inositol \(1,3,4\) P3 5/6-kinase 1, Inositol 1,3,4-trisphosphate 5/6-kinase family protein (.1)
Potri.005G149800 259 / 7e-85 AT4G08170 518 / 0.0 Inositol 1,3,4-trisphosphate 5/6-kinase family protein (.1.2.3)
Potri.009G084600 233 / 1e-74 AT4G08170 379 / 1e-131 Inositol 1,3,4-trisphosphate 5/6-kinase family protein (.1.2.3)
Potri.017G007500 80 / 2e-16 AT2G43980 534 / 0.0 "inositol 1,3,4-trisphosphate 5/6-kinase 4", inositol 1,3,4-trisphosphate 5/6-kinase 4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0179 ATP-grasp PF05770 Ins134_P3_kin Inositol 1,3,4-trisphosphate 5/6-kinase ATP-grasp domain
Representative CDS sequence
>Lus10038765 pacid=23150320 polypeptide=Lus10038765 locus=Lus10038765.g ID=Lus10038765.BGIv1.0 annot-version=v1.0
ATGGCGAAACGATACAGAGTGGGATTCGCCCTCGCTTCCAAGAAGGTCGGCAGCTTCCTCCAGCCATCCCTCATCGACTACGCCGCCGCCCGCGGCCTCG
ATCTCGTATCTATCGACTCATCAAAGCCCTTATCCGAACAGGGTCATCTCGATTGCCTCATCCACAAGTTCTACGACGACGATTGGAAGCTCCAACTCCA
ATCCTTCGCCGCCCAAAACCCCAACTCCCCGATCGTTGATCCCATCGACGCCGTTGAGAAGCTCCACAACAGGATCTCCATGCTCCAGGTCGTCAGCAAC
CTCAAGCTCGATCCTAATCGATCGGAGCGAGTGGACATTCCCAGACAGGTCGTCGTCGACTCCGATTCCGACGGATCGAAGGCTACCCAAGGTTTGGTTA
AGGAATTGGGGTTTCCTTTAATCGCCAAGCCTTTGCTGGCTAACGGATCCATTCTCTCCCACAAGATGTGTCTGATTTTCGACGGGGAAGGGTTGAAGGA
GGTGGAAGGAACTCCGATCGTGCTACAGGAGTTTGTGAACCACGGCGGGGTCATATTCAAAGTGTACGTCGCCGGGAACCATGTTCAGTGCGTAAAGAGG
AAGTCTTTGTCTGACATTTCGGAGGAGAAATTGAAAAGTCTGAAGGGCACTATGCCGTTTGCTCAGGTCTCCAATCTCGCCGACGGCGGAGATGGCCACG
GCGGGAGTGAATTCGCCGACGTGGAGATGCCACCGGAAGGGTTTGCAGAAGAGGTTGGCCGTGGGTTGAAGGAAGGAATGGGGCTTAACTTGTTCAACTT
TGATATGATTAGAGATGCCGGAGATGGGAATAGGTATCTGGTTATTGATATTAACTACTTCCCTGGGTATGCTAAGATGCCTAACTACGAGGCTGTGTTG
ACGAATTTCATCTTAGAGCTCCTGCAACAGAAGAAAGGAGAGTGA
AA sequence
>Lus10038765 pacid=23150320 polypeptide=Lus10038765 locus=Lus10038765.g ID=Lus10038765.BGIv1.0 annot-version=v1.0
MAKRYRVGFALASKKVGSFLQPSLIDYAAARGLDLVSIDSSKPLSEQGHLDCLIHKFYDDDWKLQLQSFAAQNPNSPIVDPIDAVEKLHNRISMLQVVSN
LKLDPNRSERVDIPRQVVVDSDSDGSKATQGLVKELGFPLIAKPLLANGSILSHKMCLIFDGEGLKEVEGTPIVLQEFVNHGGVIFKVYVAGNHVQCVKR
KSLSDISEEKLKSLKGTMPFAQVSNLADGGDGHGGSEFADVEMPPEGFAEEVGRGLKEGMGLNLFNFDMIRDAGDGNRYLVIDINYFPGYAKMPNYEAVL
TNFILELLQQKKGE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G16760 AtITPK1 inositol \(1,3,4\) P3 5/6-kina... Lus10038765 0 1
AT3G22070 proline-rich family protein (.... Lus10039700 1.0 0.9187
AT1G16340 ATKDSA2, ATKSDA Aldolase superfamily protein (... Lus10009596 5.3 0.8930
AT1G50380 Prolyl oligopeptidase family p... Lus10015387 6.2 0.8884
AT4G32330 TPX2 (targeting protein for Xk... Lus10002012 7.6 0.9144
AT5G02500 AtHsp70-1, AT-H... HEAT SHOCK PROTEIN 70-1, ARABI... Lus10025336 8.1 0.8898
AT5G19760 Mitochondrial substrate carrie... Lus10007883 8.7 0.8990
AT1G53240 mMDH1 mitochondrial malate dehydroge... Lus10017939 10.2 0.9086
AT1G08010 GATA GATA11 GATA transcription factor 11 (... Lus10021466 10.6 0.8854
AT3G12110 ACT11 actin-11 (.1) Lus10005457 11.1 0.9036
AT2G34590 Transketolase family protein (... Lus10038505 12.2 0.8674

Lus10038765 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.