Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039096 [exp] 83 / 2e-20 AT3G13290 131 / 2e-33 varicose-related (.1) Lus10038743 [exp] 45 / 1e-07 ND / Lus10039115 [exp] 44 / 2e-07 ND / Lus10018816 [exp] 37 / 0.0002 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G002301 [exp] 35 / 0.0005 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10038768 pacid=23150604 polypeptide=Lus10038768 locus=Lus10038768.g ID=Lus10038768.BGIv1.0 annot-version=v1.0 ATGGCGTCAACCATGAGGAAACAAGCATTGCTCCTCGCATGCATTTTGATGATGGCCACCATTGCTATTTCAGCTGATACAAAACGAGTCCCATCGGGCC CTGTTCATAGCTCTACTACCTCCCAGCCGGCTGAGTTTGTTTTCCAGCCACAAGCAGGCTGCCGTTGCTGCTATTACGTAAAGAATTCATCTGGACTCTA TGTTTGTGGCTATGTTTGCTGTGTTGATGGCTGTTGCTGA
AA sequence Show only first row Show all	>Lus10038768 pacid=23150604 polypeptide=Lus10038768 locus=Lus10038768.g ID=Lus10038768.BGIv1.0 annot-version=v1.0 MASTMRKQALLLACILMMATIAISADTKRVPSGPVHSSTTSQPAEFVFQPQAGCRCCYYVKNSSGLYVCGYVCCVDGCC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10038768 [exp]	0	1
AT5G20630		ATGER3, GLP3A, ...	GERMIN-LIKE PROTEIN 3, ARABIDO...		Lus10037663 [exp]	1.4	0.9322
AT4G36360		BGAL3	beta-galactosidase 3 (.1.2)		Lus10020968 [exp]	6.0	0.8819
AT2G02360		ATPP2-B10	phloem protein 2-B10 (.1)		Lus10003444 [exp]	9.5	0.8999
AT1G50420	GRAS	SCL-3, SCL3	scarecrow-like 3 (.1)		Lus10034374 [exp]	11.2	0.8994
AT1G14185			Glucose-methanol-choline (GMC)...		Lus10030460 [exp]	12.6	0.8989
AT2G30340	AS2	LBD13	LOB domain-containing protein ...		Lus10034208 [exp]	16.5	0.8542
AT3G53250			SAUR-like auxin-responsive pro...		Lus10009219 [exp]	19.1	0.8947
AT1G03430		AHP5	histidine-containing phosphotr...		Lus10027965 [exp]	22.4	0.7965
AT5G44390			FAD-binding Berberine family p...		Lus10008410 [exp]	23.0	0.8621
AT5G44440			FAD-binding Berberine family p...		Lus10039682 [exp]	23.6	0.8501

Compare expression of checked genes

Lus10038768 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.