Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G05030 76 / 3e-19 Copper transport protein family (.1) AT3G20180 54 / 1e-10 Copper transport protein family (.1) AT3G07600 49 / 2e-08 Heavy metal transport/detoxification superfamily protein (.1) AT5G48290 49 / 4e-08 Heavy metal transport/detoxification superfamily protein (.1.2) AT3G05920 38 / 0.0002 Heavy metal transport/detoxification superfamily protein (.1) AT5G26690 37 / 0.0004 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039093 [exp] 148 / 4e-48 AT4G05030 72 / 3e-18 Copper transport protein family (.1) Lus10016059 [exp] 54 / 2e-10 AT4G05030 62 / 2e-13 Copper transport protein family (.1) Lus10025179 [exp] 53 / 5e-10 AT4G05030 62 / 1e-13 Copper transport protein family (.1) Lus10016063 [exp] 50 / 5e-09 AT3G07600 64 / 8e-14 Heavy metal transport/detoxification superfamily protein (.1) Lus10016061 [exp] 50 / 5e-09 AT5G48290 82 / 1e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10025180 [exp] 49 / 8e-09 AT5G48290 81 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10025182 [exp] 49 / 2e-08 AT5G48290 62 / 5e-13 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10014967 [exp] 41 / 3e-05 AT1G01490 100 / 9e-27 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10027524 [exp] 40 / 0.0001 AT1G01490 100 / 2e-25 Heavy metal transport/detoxification superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G001800 [exp] 82 / 4e-22 AT4G05030 73 / 2e-18 Copper transport protein family (.1) Potri.006G001900 [exp] 81 / 1e-21 AT4G05030 88 / 3e-24 Copper transport protein family (.1) Potri.016G002600 [exp] 65 / 3e-15 AT4G05030 72 / 2e-18 Copper transport protein family (.1) Potri.001G468500 [exp] 64 / 2e-14 AT4G05030 65 / 1e-14 Copper transport protein family (.1) Potri.014G171300 [exp] 57 / 1e-11 AT3G07600 75 / 5e-18 Heavy metal transport/detoxification superfamily protein (.1) Potri.006G002000 [exp] 54 / 7e-11 AT4G05030 54 / 3e-11 Copper transport protein family (.1) Potri.009G048100 [exp] 53 / 4e-10 AT3G07600 79 / 8e-20 Heavy metal transport/detoxification superfamily protein (.1) Potri.009G048400 [exp] 52 / 6e-10 AT3G07600 80 / 3e-20 Heavy metal transport/detoxification superfamily protein (.1) Potri.014G171500 [exp] 52 / 1e-09 AT3G07600 73 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1) Potri.001G378700 [exp] 50 / 3e-09 AT3G20180 56 / 5e-11 Copper transport protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [flax] [poplar] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Lus10038769 pacid=23150253 polypeptide=Lus10038769 locus=Lus10038769.g ID=Lus10038769.BGIv1.0 annot-version=v1.0 ATGAGGGAAGCCAAAGTAGGCTATTCATTCACCCTTCCTCATTCGTCAATGTCTACTCCCACAATTATGATTACCGAGAACAAGATCGTGTACAGGCTGC AGCTTAGTTGCCAGAAATGCCAAACCAAGGCACTCCAGGTTGCTGCAGAGGCAAAGGGTGTCAACTACGTGGGTTTCGAAGGAGATTCGAAGGAGAATTT GGTGGTGGTGGGGGATGATGTGGATCCGGTGAAGCTAGCCATTAAGTTGAGGAAGAAAGTTAAGGTGGCAGAAATCCTCAGTGTTACTATTGTAGATTCA GCTTGA
AA sequence Show only first row Show all	>Lus10038769 pacid=23150253 polypeptide=Lus10038769 locus=Lus10038769.g ID=Lus10038769.BGIv1.0 annot-version=v1.0 MREAKVGYSFTLPHSSMSTPTIMITENKIVYRLQLSCQKCQTKALQVAAEAKGVNYVGFEGDSKENLVVVGDDVDPVKLAIKLRKKVKVAEILSVTIVDS A

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G05030			Copper transport protein famil...		Lus10038769 [exp]	0	1
AT5G52450			MATE efflux family protein (.1...		Lus10019492 [exp]	86.9	0.7411
AT4G23290		CRK21	cysteine-rich RLK (RECEPTOR-li...		Lus10028026 [exp]	210.9	0.7434

Compare expression of checked genes

Lus10038769 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.