Lus10038782 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G47630 112 / 8e-33 MTACP3 mitochondrial acyl carrier protein 3 (.1.2)
AT2G44620 85 / 3e-22 MTACP1, MTACP-1 mitochondrial acyl carrier protein 1 (.1)
AT1G65290 75 / 3e-18 MTACP2 mitochondrial acyl carrier protein 2 (.1)
AT3G05020 44 / 3e-06 ACP1 acyl carrier protein 1 (.1)
AT1G54630 41 / 3e-05 ACP3 acyl carrier protein 3 (.1.2)
AT1G54580 41 / 4e-05 ACP2 acyl carrier protein 2 (.1)
AT5G27200 40 / 7e-05 ACP5 acyl carrier protein 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039077 240 / 9e-84 AT5G47630 119 / 1e-35 mitochondrial acyl carrier protein 3 (.1.2)
Lus10000050 240 / 9e-84 AT5G47630 119 / 1e-35 mitochondrial acyl carrier protein 3 (.1.2)
Lus10020221 87 / 5e-23 AT1G65290 183 / 4e-61 mitochondrial acyl carrier protein 2 (.1)
Lus10026849 86 / 2e-20 AT1G08450 590 / 0.0 PRIORITY IN SWEET LIFE 1, EMS-MUTAGENIZED BRI1 SUPPRESSOR 2, A. thaliana calreticulin 3, calreticulin 3 (.1.2.3)
Lus10043348 77 / 3e-19 AT2G44620 186 / 1e-62 mitochondrial acyl carrier protein 1 (.1)
Lus10019500 77 / 3e-19 AT2G44620 186 / 1e-62 mitochondrial acyl carrier protein 1 (.1)
Lus10038636 44 / 3e-06 AT4G25050 134 / 3e-41 acyl carrier protein 4 (.1.2)
Lus10038635 44 / 3e-06 AT4G25050 134 / 3e-41 acyl carrier protein 4 (.1.2)
Lus10037910 40 / 8e-05 AT4G25050 130 / 4e-40 acyl carrier protein 4 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G005700 160 / 7e-52 AT5G47630 107 / 5e-31 mitochondrial acyl carrier protein 3 (.1.2)
Potri.016G006300 145 / 7e-46 AT5G47630 111 / 1e-32 mitochondrial acyl carrier protein 3 (.1.2)
Potri.019G055300 80 / 4e-20 AT1G65290 196 / 6e-66 mitochondrial acyl carrier protein 2 (.1)
Potri.013G084500 79 / 1e-19 AT1G65290 188 / 5e-63 mitochondrial acyl carrier protein 2 (.1)
Potri.014G044000 77 / 5e-19 AT2G44620 163 / 2e-53 mitochondrial acyl carrier protein 1 (.1)
Potri.002G135600 68 / 1e-15 AT2G44620 177 / 1e-58 mitochondrial acyl carrier protein 1 (.1)
Potri.006G217800 42 / 1e-05 AT1G54630 94 / 2e-25 acyl carrier protein 3 (.1.2)
Potri.015G104500 40 / 5e-05 AT4G25050 122 / 2e-36 acyl carrier protein 4 (.1.2)
Potri.012G105300 38 / 0.0004 AT4G25050 107 / 8e-31 acyl carrier protein 4 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0314 PP-binding PF00550 PP-binding Phosphopantetheine attachment site
Representative CDS sequence
>Lus10038782 pacid=23150671 polypeptide=Lus10038782 locus=Lus10038782.g ID=Lus10038782.BGIv1.0 annot-version=v1.0
ATGCAGAGTGTCAGAAATTTTTTTTTGAGCCATATCAGGGTGAGGGTAGTTCCCGAACAATGGTCGCATCATCAGAGGGCTGGTCTGTTCAAGAAATTGC
AAATGGGATTTTGTGCTGCAACGGATGCAATTCCTGAGCACATTATGAATCGGGTTATTGGATTGGTTAAGAAATTTGACAAAATAGAAGCCAACAAGGT
TACTGAAACAGCTTATTTCCAGCAAGATTTATGCCTGGACAGTCTAGACAGGGTGGAGCTTGTCATGGCTTTCGAAGAGGAGTTTGATGTTGTGATCCCT
GATAAAGAAGCAGACAAACTCTTGTGCTGTGCTGATGTTGCAAGATTTATATCTTCTGCAAACAGATCGTAA
AA sequence
>Lus10038782 pacid=23150671 polypeptide=Lus10038782 locus=Lus10038782.g ID=Lus10038782.BGIv1.0 annot-version=v1.0
MQSVRNFFLSHIRVRVVPEQWSHHQRAGLFKKLQMGFCAATDAIPEHIMNRVIGLVKKFDKIEANKVTETAYFQQDLCLDSLDRVELVMAFEEEFDVVIP
DKEADKLLCCADVARFISSANRS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G47630 MTACP3 mitochondrial acyl carrier pro... Lus10038782 0 1
AT2G41600 Mitochondrial glycoprotein fam... Lus10042041 3.9 0.7437
AT5G04000 unknown protein Lus10018038 5.3 0.7745
AT5G49550 BLOS2 BLOC subunit 2, unknown protei... Lus10019163 6.2 0.7540
AT5G23680 Sterile alpha motif (SAM) doma... Lus10036012 8.1 0.7431
AT2G32520 alpha/beta-Hydrolases superfam... Lus10035287 9.4 0.7442
AT1G61700 RNA polymerases N / 8 kDa subu... Lus10038195 13.4 0.7073
AT3G60480 unknown protein Lus10034728 14.8 0.7233
AT5G01600 ATFER1 ARABIDOPSIS THALIANA FERRETIN ... Lus10002865 17.2 0.7519
AT3G09890 Ankyrin repeat family protein ... Lus10023911 18.7 0.7158
AT3G13845 unknown protein Lus10015617 18.7 0.7240

Lus10038782 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.