Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G15395 81 / 2e-22 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039067 [exp] 107 / 4e-33 AT3G15395 83 / 3e-23 unknown protein Lus10027849 [exp] 104 / 7e-32 AT3G15395 83 / 2e-23 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G402000 [exp] 76 / 1e-20 AT3G15395 79 / 1e-21 unknown protein Potri.006G225232 [exp] 57 / 7e-13 AT3G15395 58 / 3e-13 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10038792 pacid=23150484 polypeptide=Lus10038792 locus=Lus10038792.g ID=Lus10038792.BGIv1.0 annot-version=v1.0 ATGGGAGTCCGTGGTGTTATAGGTGATAAATGGTCCATGAGGATTCTCTGGCTGTGTGCTATAGGCAGTGCAGCAGGTCTGTACATGGTTGCAGTTGAAA GACAAGCACAAAACAGACAACGGATGAATGCTGAAACTTTAATGAGTCTGGATGAAGATGGTGACGATGTTTAG
AA sequence Show only first row Show all	>Lus10038792 pacid=23150484 polypeptide=Lus10038792 locus=Lus10038792.g ID=Lus10038792.BGIv1.0 annot-version=v1.0 MGVRGVIGDKWSMRILWLCAIGSAAGLYMVAVERQAQNRQRMNAETLMSLDEDGDDV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G15395			unknown protein		Lus10038792 [exp]	0	1
AT1G64520		RPN12A	regulatory particle non-ATPase...		Lus10032420 [exp]	6.3	0.9037
AT2G33040		ATP3	gamma subunit of Mt ATP syntha...		Lus10042366 [exp]	9.9	0.8971
AT5G35620		eIFiso4E, EIF(I...	LOSS OF SUSCEPTIBILITY TO POTY...		Lus10023733 [exp]	17.8	0.8903
AT1G42960			unknown protein		Lus10012242 [exp]	20.1	0.8960
AT5G24070			Peroxidase superfamily protein...		Lus10022962 [exp]	20.2	0.8924
AT5G16890			Exostosin family protein (.1)		Lus10039145 [exp]	20.6	0.8776
AT1G30440			Phototropic-responsive NPH3 fa...		Lus10038531 [exp]	21.0	0.8925
AT5G20500			Glutaredoxin family protein (....		Lus10017148 [exp]	22.3	0.8900
AT5G57290			60S acidic ribosomal protein f...		Lus10012714 [exp]	32.6	0.8837
AT1G04850			ubiquitin-associated (UBA)/TS-...		Lus10037827 [exp]	33.1	0.8843

Compare expression of checked genes

Lus10038792 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.