Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09950 82 / 8e-22 unknown protein AT3G55570 77 / 1e-19 unknown protein AT5G55620 73 / 3e-18 unknown protein AT5G41761 72 / 9e-18 unknown protein AT3G11405 57 / 2e-11 unknown protein AT5G06010 50 / 3e-09 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039065 [exp] 167 / 2e-55 AT3G09950 85 / 6e-23 unknown protein Lus10012634 [exp] 77 / 7e-20 AT5G41761 85 / 6e-23 unknown protein Lus10000541 [exp] 77 / 1e-19 AT5G41761 96 / 2e-27 unknown protein Lus10017552 [exp] 74 / 5e-18 AT5G41761 94 / 2e-25 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G017700 [exp] 107 / 2e-31 AT5G41761 83 / 6e-22 unknown protein Potri.014G095000 [exp] 78 / 3e-20 AT5G41761 97 / 1e-27 unknown protein Potri.003G136700 [exp] 77 / 5e-20 AT5G41761 102 / 4e-30 unknown protein Potri.001G313700 [exp] 74 / 7e-19 AT3G55570 93 / 2e-26 unknown protein Potri.001G313801 [exp] 75 / 8e-19 AT3G55570 85 / 1e-22 unknown protein Potri.012G031900 [exp] 74 / 1e-18 AT5G41761 88 / 2e-24 unknown protein Potri.014G095100 [exp] 72 / 5e-18 AT5G41761 92 / 3e-26 unknown protein Potri.002G167900 [exp] 71 / 2e-17 AT5G41761 86 / 1e-23 unknown protein Potri.001G364550 [exp] 36 / 0.0004 AT5G41761 39 / 5e-05 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10038794 pacid=23150588 polypeptide=Lus10038794 locus=Lus10038794.g ID=Lus10038794.BGIv1.0 annot-version=v1.0 ATGGCGGAGTTGATGAAAGCGATTCTCCACTCGGCGTGCCATGTCGTCGGCTACTCCAAAGTCGAATCACCATCCCCCGCCACCAAGTGCAAAACCAGCA GAGTCGCAGTAACGCCGCCGCCGCCGACGAAGACGACAGAGTTCAGGATGCCGCTTCATTACCCGAGGTACAGCAAGAAGGATTACGAAGGGATGGAAGA GTGGAGGCTGGATCTTCTCTTCTCGCAGTACGGTCTCCGTTTCGATGGCTCCCTGGCCGAGAAGCGCGCTTACGCCATTGGAGCCTTCCTCTGGCCTGAC CAGTATTGA
AA sequence Show only first row Show all	>Lus10038794 pacid=23150588 polypeptide=Lus10038794 locus=Lus10038794.g ID=Lus10038794.BGIv1.0 annot-version=v1.0 MAELMKAILHSACHVVGYSKVESPSPATKCKTSRVAVTPPPPTKTTEFRMPLHYPRYSKKDYEGMEEWRLDLLFSQYGLRFDGSLAEKRAYAIGAFLWPD QY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G09950			unknown protein		Lus10038794 [exp]	0	1
AT5G07030			Eukaryotic aspartyl protease f...		Lus10026171 [exp]	5.3	0.8139
AT1G78270		ATUGT85A4	UDP-glucosyl transferase 85A4 ...		Lus10036969 [exp]	5.5	0.8241
AT1G67290		GLOX1	glyoxal oxidase 1, glyoxal oxi...		Lus10012981 [exp]	5.7	0.8492
AT1G68560		AXY3, TRG1, XYL...	thermoinhibition resistant ger...		Lus10034315 [exp]	6.6	0.8514
AT1G67290		GLOX1	glyoxal oxidase 1, glyoxal oxi...		Lus10012980 [exp]	7.7	0.8419
AT4G33280	B3	REM16	AP2/B3-like transcriptional fa...		Lus10032873 [exp]	10.9	0.7935
					Lus10025138 [exp]	12.8	0.7624
AT1G67290		GLOX1	glyoxal oxidase 1, glyoxal oxi...		Lus10034959 [exp]	13.7	0.8021
AT5G41460			Protein of unknown function (D...		Lus10028768 [exp]	18.3	0.8064
					Lus10039034 [exp]	18.7	0.7994

Compare expression of checked genes

Lus10038794 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.