Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G35740 144 / 6e-46 Carbohydrate-binding X8 domain superfamily protein (.1) AT2G04910 122 / 7e-37 Carbohydrate-binding X8 domain superfamily protein (.1.2) AT4G29360 98 / 6e-25 O-Glycosyl hydrolases family 17 protein (.1.2) AT1G79480 95 / 6e-24 Carbohydrate-binding X8 domain superfamily protein (.1.2) AT3G13560 90 / 3e-22 O-Glycosyl hydrolases family 17 protein (.1.2.3) AT1G29380 88 / 5e-22 Carbohydrate-binding X8 domain superfamily protein (.1) AT1G11820 89 / 1e-21 O-Glycosyl hydrolases family 17 protein (.1.2) AT2G30933 84 / 2e-21 Carbohydrate-binding X8 domain superfamily protein (.1.2) AT4G05430 83 / 2e-21 Carbohydrate-binding X8 domain superfamily protein (.1) AT2G05790 87 / 4e-21 O-Glycosyl hydrolases family 17 protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039059 [exp] 181 / 6e-60 AT5G35740 157 / 3e-50 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10012324 [exp] 138 / 2e-43 AT5G35740 164 / 8e-54 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10001167 [exp] 128 / 2e-39 AT5G35740 150 / 3e-48 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10001740 [exp] 94 / 5e-26 AT5G35740 111 / 2e-33 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10002466 [exp] 93 / 1e-24 AT5G67460 175 / 1e-53 O-Glycosyl hydrolases family 17 protein (.1) Lus10015151 [exp] 96 / 5e-24 AT2G05790 731 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Lus10000278 [exp] 94 / 7e-24 AT1G79480 164 / 7e-47 Carbohydrate-binding X8 domain superfamily protein (.1.2) Lus10001764 [exp] 94 / 1e-23 AT1G79480 165 / 2e-47 Carbohydrate-binding X8 domain superfamily protein (.1.2) Lus10010478 [exp] 92 / 9e-23 AT3G20650 570 / 0.0 mRNA capping enzyme family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G016800 [exp] 151 / 1e-48 AT5G35740 156 / 1e-50 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.014G164600 [exp] 141 / 8e-45 AT5G35740 179 / 8e-60 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.008G082900 [exp] 91 / 7e-23 AT1G79480 159 / 3e-45 Carbohydrate-binding X8 domain superfamily protein (.1.2) Potri.006G008200 [exp] 89 / 9e-23 AT1G79480 142 / 8e-40 Carbohydrate-binding X8 domain superfamily protein (.1.2) Potri.017G055700 [exp] 87 / 1e-22 AT4G13600 152 / 3e-46 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.003G218500 [exp] 90 / 5e-22 AT3G13560 594 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2.3) Potri.001G006500 [exp] 90 / 5e-22 AT3G13560 632 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2.3) Potri.010G173500 [exp] 87 / 3e-21 AT1G79480 162 / 3e-46 Carbohydrate-binding X8 domain superfamily protein (.1.2) Potri.018G068600 [exp] 86 / 9e-21 AT5G56590 685 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Potri.014G158400 [exp] 86 / 1e-20 AT2G05790 751 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07983 [flax] [poplar] X8 X8 domain
Representative CDS sequence Show only first row Show all	>Lus10038801 pacid=23150416 polypeptide=Lus10038801 locus=Lus10038801.g ID=Lus10038801.BGIv1.0 annot-version=v1.0 ATGTCTCTGCGATCATCGTCTCTGATACTAGTTCCTCGGCTTCTGCTTCTTGGGGTTGCTCTCTTCCCATTGATCTCAGATGGGGAGCGATTGGTGGGAG GTTTCGAGGCGAAGGAATGGTGCATAGCGGACGAGCAGACACCAGACGACGAGTTGCAGAGTGCACTGGATTGGGCGTGTGGGAAAGCAGGAGGTGCAGA TTGCTCCAAGTTGCAGAAGAACCAGCCTTGTTTCCTCCCCAACACCATAAGGGGCCATGCCTCTTTTGCCTTCAACAGCTACTACCAGAGGTTTAAGAGG AAAGGGGCCACCTGCTACTTCAATTCTGCTGCCATGGTCACCGACCTTGATCCAAGTAAGTAA
AA sequence Show only first row Show all	>Lus10038801 pacid=23150416 polypeptide=Lus10038801 locus=Lus10038801.g ID=Lus10038801.BGIv1.0 annot-version=v1.0 MSLRSSSLILVPRLLLLGVALFPLISDGERLVGGFEAKEWCIADEQTPDDELQSALDWACGKAGGADCSKLQKNQPCFLPNTIRGHASFAFNSYYQRFKR KGATCYFNSAAMVTDLDPSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G35740			Carbohydrate-binding X8 domain...		Lus10038801 [exp]	0	1
AT5G42930			alpha/beta-Hydrolases superfam...		Lus10005092 [exp]	1.0	0.9449
AT4G05220			Late embryogenesis abundant (L...		Lus10006755 [exp]	3.5	0.9210
AT5G14890			NHL domain-containing protein ...		Lus10014529 [exp]	3.5	0.9036
AT2G27140			HSP20-like chaperones superfam...		Lus10003356 [exp]	10.7	0.9124
AT4G15450			Senescence/dehydration-associa...		Lus10034970 [exp]	12.0	0.8639
AT5G35740			Carbohydrate-binding X8 domain...		Lus10039059 [exp]	13.6	0.8866
					Lus10035810 [exp]	15.0	0.8756
AT3G15800			Glycosyl hydrolase superfamily...		Lus10011482 [exp]	15.9	0.8849
AT1G27180			disease resistance protein (TI...		Lus10007831 [exp]	17.9	0.8903
AT1G31500			DNAse I-like superfamily prote...		Lus10026203 [exp]	19.6	0.8277

Compare expression of checked genes

Lus10038801 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.