Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16450 189 / 4e-64 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039057 [exp] 209 / 4e-72 AT4G16450 188 / 1e-63 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G016300 [exp] 191 / 5e-65 AT4G16450 185 / 2e-62 unknown protein Potri.016G009600 [exp] 179 / 3e-60 AT4G16450 172 / 3e-57 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10785 [flax] [poplar] NADH-u_ox-rdase NADH-ubiquinone oxidoreductase complex I, 21 kDa subunit
Representative CDS sequence Show only first row Show all	>Lus10038803 pacid=23150634 polypeptide=Lus10038803 locus=Lus10038803.g ID=Lus10038803.BGIv1.0 annot-version=v1.0 ATGAACACTGACATTACAGCATCGACGAAGCCGGAGTACCCGGTCATAGATCGGAATCCGGCATTCACCAAGGTGGTTGGTAACTTCAGCACCTTGGATT ATCTCCGCTTCACCACCATCACCGGCGTCTCCGTCACCGTCGGCTATCTTTCAGGGATTAAGCCAGGGCTCAAAGGACCATCTATGGTGACAGGGGGGCT AATTGGGTTACTGGGTGGGTTCATGTACGCTTACCAGAACTCTGCTGGGCGGCTCATGGGGTTCTTCCCCAACGAGGGCGAGGTTGCTTCTTACCAAAAG AGCGGATACAAGAACTGA
AA sequence Show only first row Show all	>Lus10038803 pacid=23150634 polypeptide=Lus10038803 locus=Lus10038803.g ID=Lus10038803.BGIv1.0 annot-version=v1.0 MNTDITASTKPEYPVIDRNPAFTKVVGNFSTLDYLRFTTITGVSVTVGYLSGIKPGLKGPSMVTGGLIGLLGGFMYAYQNSAGRLMGFFPNEGEVASYQK SGYKN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G16450			unknown protein		Lus10038803 [exp]	0	1
AT4G00585			unknown protein		Lus10007571 [exp]	1.0	0.8935
AT1G79010			Alpha-helical ferredoxin (.1)		Lus10023571 [exp]	1.4	0.8536
AT2G38130		ATMAK3	Acyl-CoA N-acyltransferases (N...		Lus10012579 [exp]	4.5	0.7704
AT2G15910			CSL zinc finger domain-contain...		Lus10023841 [exp]	4.5	0.8146
AT2G27730			copper ion binding (.1)		Lus10004865 [exp]	4.9	0.7648
AT3G62790			NADH-ubiquinone oxidoreductase...		Lus10035034 [exp]	5.5	0.8231
					Lus10008962 [exp]	5.5	0.7587
AT3G26360			Ribosomal protein S21 family p...		Lus10006466 [exp]	5.8	0.7724
AT5G62030			diphthamide synthesis DPH2 fam...		Lus10039108 [exp]	8.8	0.7859
AT2G02050			NADH-ubiquinone oxidoreductase...		Lus10035094 [exp]	9.5	0.7912

Compare expression of checked genes

Lus10038803 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.