Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10038805 pacid=23150461 polypeptide=Lus10038805 locus=Lus10038805.g ID=Lus10038805.BGIv1.0 annot-version=v1.0 ATGAGGCTGGTCGTGGAAGAAACCGCGGTAGAGACCCCGAGGATCGAGTTGAAGCTTGTGTCGGGTGATCAGTACCTGAACTGGAAGAAGAGCGTCCGTC CGTTGGACTTCAAGAGTACCACCGTACGTGGACCAACTCAAGGCTCAGGTTTCCTTACAGACCAGCAGGATCCGACAGATGGTGGCCGTTGGATCAGGCC ACTTTTGGGTCAACTTTCATCAATGGTTGAGAATGAGTCAGACGAATTAACTTGA
AA sequence Show only first row Show all	>Lus10038805 pacid=23150461 polypeptide=Lus10038805 locus=Lus10038805.g ID=Lus10038805.BGIv1.0 annot-version=v1.0 MRLVVEETAVETPRIELKLVSGDQYLNWKKSVRPLDFKSTTVRGPTQGSGFLTDQQDPTDGGRWIRPLLGQLSSMVENESDELT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10038805 [exp]	0	1
AT1G68640	bZIP	PAN	PERIANTHIA, bZIP transcription...		Lus10041475 [exp]	9.0	0.7518
AT1G49170			Protein of unknown function (D...		Lus10020853 [exp]	9.2	0.7338
AT3G10490	NAC	ANAC051, ANAC05...	Arabidopsis NAC domain contain...		Lus10038670 [exp]	17.0	0.7500
AT5G62360			Plant invertase/pectin methyle...		Lus10032233 [exp]	18.3	0.7514
AT2G27110	FAR1_related	FRS3	FAR1-related sequence 3 (.1.2....		Lus10026767 [exp]	20.2	0.7329
AT4G37810			unknown protein		Lus10011570 [exp]	24.5	0.7195
AT2G28380		DRB2	dsRNA-binding protein 2 (.1)		Lus10000721 [exp]	24.7	0.6909
AT2G26470			unknown protein		Lus10038230 [exp]	25.0	0.7315
AT5G41610		ATCHX18	cation/H+ exchanger 18, ARABID...		Lus10017541 [exp]	26.7	0.7066
AT3G04670	WRKY	ATWRKY39, WRKY3...	WRKY DNA-binding protein 39 (....		Lus10033857 [exp]	34.8	0.7150

Compare expression of checked genes

Lus10038805 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.