Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16490 160 / 2e-48 ARM repeat superfamily protein (.1) AT3G01400 102 / 3e-27 ARM repeat superfamily protein (.1) AT5G67340 101 / 3e-26 ARM repeat superfamily protein (.1) AT3G54790 99 / 4e-25 ARM repeat superfamily protein (.1.2) AT2G23140 96 / 3e-24 RING/U-box superfamily protein with ARM repeat domain (.1.2) AT5G58680 89 / 5e-22 ARM repeat superfamily protein (.1) AT4G12710 64 / 4e-13 ARM repeat superfamily protein (.1) AT3G54850 61 / 4e-12 ATPUB14 plant U-box 14 (.1) AT5G14510 61 / 8e-12 ARM repeat superfamily protein (.1) AT1G23030 56 / 4e-10 PUB11 ARM repeat superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039047 [exp] 219 / 2e-71 AT4G16490 549 / 0.0 ARM repeat superfamily protein (.1) Lus10010499 [exp] 187 / 2e-58 AT4G16490 608 / 0.0 ARM repeat superfamily protein (.1) Lus10017562 [exp] 165 / 4e-54 AT4G16490 149 / 3e-44 ARM repeat superfamily protein (.1) Lus10007738 [exp] 103 / 2e-27 AT3G01400 555 / 0.0 ARM repeat superfamily protein (.1) Lus10011514 [exp] 102 / 3e-26 AT2G23140 916 / 0.0 RING/U-box superfamily protein with ARM repeat domain (.1.2) Lus10019308 [exp] 100 / 1e-25 AT2G23140 911 / 0.0 RING/U-box superfamily protein with ARM repeat domain (.1.2) Lus10032023 [exp] 97 / 4e-25 AT2G23140 309 / 1e-98 RING/U-box superfamily protein with ARM repeat domain (.1.2) Lus10024899 [exp] 94 / 3e-23 AT2G23140 551 / 0.0 RING/U-box superfamily protein with ARM repeat domain (.1.2) Lus10011516 [exp] 90 / 6e-22 AT2G23140 410 / 5e-134 RING/U-box superfamily protein with ARM repeat domain (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G010800 [exp] 162 / 7e-49 AT4G16490 521 / 0.0 ARM repeat superfamily protein (.1) Potri.006G015100 [exp] 150 / 2e-44 AT4G16490 509 / 1e-178 ARM repeat superfamily protein (.1) Potri.014G016400 [exp] 99 / 5e-26 AT3G01400 557 / 0.0 ARM repeat superfamily protein (.1) Potri.007G051000 [exp] 100 / 8e-26 AT2G23140 1018 / 0.0 RING/U-box superfamily protein with ARM repeat domain (.1.2) Potri.005G144700 [exp] 99 / 3e-25 AT2G23140 972 / 0.0 RING/U-box superfamily protein with ARM repeat domain (.1.2) Potri.002G118800 [exp] 96 / 9e-25 AT3G01400 521 / 0.0 ARM repeat superfamily protein (.1) Potri.005G225400 [exp] 97 / 1e-24 AT3G54790 736 / 0.0 ARM repeat superfamily protein (.1.2) Potri.002G037700 [exp] 96 / 2e-24 AT3G54790 707 / 0.0 ARM repeat superfamily protein (.1.2) Potri.014G170100 [exp] 73 / 3e-16 AT4G12710 422 / 3e-147 ARM repeat superfamily protein (.1) Potri.017G128100 [exp] 72 / 6e-16 AT3G03440 380 / 2e-130 ARM repeat superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10038811 pacid=23150448 polypeptide=Lus10038811 locus=Lus10038811.g ID=Lus10038811.BGIv1.0 annot-version=v1.0 ATGATGGTGGGCGAGCAAGGGTCAGGGATGGCAGAGAAAGCCATGGTGATACTGAACAGCCTTGCAGGCGTTGAAGAAGGGAAAGAAGCAATCGTGGAGG AAGGTGGGATTGCTGCTCTAGTGGAAGCCATAGAAGATGGCTCTCCAAAAGGGGAAGAGTTCTCAGTGCTGATACTGCTCCAATTGTGCTGTGCAAGTGT GAAGAATCGTGGGTTGCTGGTTAGGGAAGGTGGGATTCCTCCTCTTGTGGCACTTTCTCAGAGTGGGACTGTCCGGGCCATGCATAAGGCAGAGACTCTT CTGGTATACTTGAGAGAATCAAGACAACTGGGTTCTTCATCTGCAACTCCTTAA
AA sequence Show only first row Show all	>Lus10038811 pacid=23150448 polypeptide=Lus10038811 locus=Lus10038811.g ID=Lus10038811.BGIv1.0 annot-version=v1.0 MMVGEQGSGMAEKAMVILNSLAGVEEGKEAIVEEGGIAALVEAIEDGSPKGEEFSVLILLQLCCASVKNRGLLVREGGIPPLVALSQSGTVRAMHKAETL LVYLRESRQLGSSSATP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G16490			ARM repeat superfamily protein...		Lus10038811 [exp]	0	1
AT4G16490			ARM repeat superfamily protein...		Lus10039047 [exp]	1.7	0.8802
AT3G28480			Oxoglutarate/iron-dependent ox...		Lus10032183 [exp]	3.0	0.8282
AT4G16490			ARM repeat superfamily protein...		Lus10038812 [exp]	5.2	0.8458
AT5G05340			Peroxidase superfamily protein...		Lus10029065 [exp]	6.0	0.8314
AT5G08060			unknown protein		Lus10040513 [exp]	6.2	0.8717
AT2G18910			hydroxyproline-rich glycoprote...		Lus10006958 [exp]	9.8	0.8243
AT2G38610			RNA-binding KH domain-containi...		Lus10035015 [exp]	10.5	0.8282
AT2G30920		ATCOQ3, EMB3002	embryo defective 3002, coenzym...		Lus10020863 [exp]	12.2	0.7837
AT2G43090			Aconitase/3-isopropylmalate de...		Lus10007804 [exp]	15.9	0.8415
AT5G44120		ATCRA1, CRU1, C...	CRUCIFERINA, RmlC-like cupins ...		Lus10011816 [exp]	17.4	0.7932

Compare expression of checked genes

Lus10038811 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.