Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16490 71 / 2e-15 ARM repeat superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017563 [exp] 82 / 3e-20 AT4G16490 198 / 5e-61 ARM repeat superfamily protein (.1) Lus10010499 [exp] 84 / 4e-20 AT4G16490 608 / 0.0 ARM repeat superfamily protein (.1) Lus10039047 [exp] 69 / 1e-14 AT4G16490 549 / 0.0 ARM repeat superfamily protein (.1) Lus10014691 [exp] 61 / 7e-12 AT4G16490 195 / 3e-59 ARM repeat superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G010800 [exp] 71 / 2e-15 AT4G16490 521 / 0.0 ARM repeat superfamily protein (.1) Potri.006G015100 [exp] 62 / 4e-12 AT4G16490 509 / 1e-178 ARM repeat superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10038812 pacid=23150353 polypeptide=Lus10038812 locus=Lus10038812.g ID=Lus10038812.BGIv1.0 annot-version=v1.0 ATGCGCACTATCCGCTCCAACCTCTCTCACAACGCCGCCGACGACAACAGCTGCTCTTCCTTCACCACCGCCACCGCTCCCGCTCACCAATCCTCTTTCG TCTCTGAGAACTTGACCGACTCTGTTATCGACATCCGCCTCGGGGAGCTCGCCGCCAGGAATTTCTTGAACAGTTCGGGTGCTAAATCCGGGAAATCCAC TGCTGCATTCACCACAGCGGAAGCGCTCGAGTTTCTAGACGTCTCTCAGGCGTTCAGCGATTTCTCCGCCTGTAGCAGCGACATCTCCGGCGAGATAGCT CGTCTGGCCCGGCGAGATAGCTCGCCTGGCCAGCTTGCCTTCTCCTAG
AA sequence Show only first row Show all	>Lus10038812 pacid=23150353 polypeptide=Lus10038812 locus=Lus10038812.g ID=Lus10038812.BGIv1.0 annot-version=v1.0 MRTIRSNLSHNAADDNSCSSFTTATAPAHQSSFVSENLTDSVIDIRLGELAARNFLNSSGAKSGKSTAAFTTAEALEFLDVSQAFSDFSACSSDISGEIA RLARRDSSPGQLAFS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G16490			ARM repeat superfamily protein...		Lus10038812 [exp]	0	1
AT4G16490			ARM repeat superfamily protein...		Lus10039047 [exp]	1.0	0.8872
AT3G47520		pNAD-MDH, MDH	plastidic NAD-dependent malate...		Lus10000275 [exp]	1.4	0.8863
AT4G16490			ARM repeat superfamily protein...		Lus10038811 [exp]	5.2	0.8458
AT4G22780		ACR7	ACT domain repeat 7 (.1)		Lus10006662 [exp]	7.4	0.8617
AT2G47420		DIM1A	adenosine dimethyl transferase...		Lus10017864 [exp]	9.5	0.8326
AT1G14020			O-fucosyltransferase family pr...		Lus10026624 [exp]	10.2	0.8790
AT4G23490			Protein of unknown function (D...		Lus10032293 [exp]	12.0	0.8635
AT2G25270			unknown protein		Lus10038102 [exp]	18.3	0.8517
AT5G42200			RING/U-box superfamily protein...		Lus10017253 [exp]	23.0	0.7700
AT2G26730			Leucine-rich repeat protein ki...		Lus10033065 [exp]	23.7	0.8341

Compare expression of checked genes

Lus10038812 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.