Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G53160 285 / 5e-99 RCAR3, PYL8 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) AT1G01360 275 / 6e-95 PYL9, RCAR1 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) AT4G27920 270 / 5e-93 RCAR4, PYL10 regulatory components of ABA receptor 4, PYR1-like 10 (.1) AT4G01026 258 / 6e-88 RCAR2, PYL7 regulatory components of ABA receptor 2, PYR1-like 7 (.1) AT5G05440 172 / 3e-54 RCAR8, PYL5 regulatory component of ABA receptor 8, PYRABACTIN RESISTANCE 1-LIKE 5, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT2G26040 166 / 4e-52 RCAR14, PYL2 regulatory components of ABA receptor 14, PYR1-like 2 (.1) AT2G40330 164 / 4e-51 RCAR9, PYL6 regulatory components of ABA receptor 9, PYR1-like 6 (.1) AT2G38310 160 / 1e-49 RCAR10, PYL4 regulatory components of ABA receptor 10, PYR1-like 4 (.1) AT4G17870 157 / 3e-48 RCAR11, PYR1 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G73000 141 / 4e-42 RCAR13, PYL3 regulatory components of ABA receptor 13, PYR1-like 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014929 [exp] 380 / 7e-136 AT5G53160 289 / 2e-100 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Lus10001059 [exp] 320 / 1e-112 AT5G53160 306 / 1e-107 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Lus10039335 [exp] 309 / 5e-108 AT5G53160 295 / 4e-103 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Lus10040916 [exp] 247 / 8e-84 AT1G01360 265 / 1e-91 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) Lus10014239 [exp] 177 / 8e-56 AT2G38310 250 / 5e-85 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10022675 [exp] 176 / 1e-54 AT2G38310 249 / 1e-83 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10012231 [exp] 171 / 3e-53 AT2G38310 234 / 1e-78 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10007530 [exp] 159 / 5e-50 AT2G38310 198 / 1e-65 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10007275 [exp] 151 / 3e-46 AT2G40330 183 / 1e-58 regulatory components of ABA receptor 9, PYR1-like 6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G020500 [exp] 298 / 3e-104 AT5G53160 304 / 7e-107 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Potri.012G000800 [exp] 295 / 1e-102 AT5G53160 303 / 1e-106 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Potri.003G139200 [exp] 295 / 1e-102 AT5G53160 297 / 3e-104 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Potri.001G092500 [exp] 293 / 3e-102 AT5G53160 296 / 7e-104 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Potri.002G169400 [exp] 288 / 2e-100 AT1G01360 305 / 2e-107 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) Potri.014G097100 [exp] 285 / 6e-99 AT1G01360 301 / 6e-106 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) Potri.016G125400 [exp] 179 / 8e-57 AT2G38310 256 / 3e-87 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.006G104100 [exp] 176 / 2e-55 AT2G38310 249 / 2e-84 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.001G142500 [exp] 171 / 6e-54 AT4G17870 286 / 1e-99 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.018G054400 [exp] 170 / 1e-53 AT2G26040 273 / 1e-94 regulatory components of ABA receptor 14, PYR1-like 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [flax] [poplar] Bet_v_1_like PF10604 [flax] [poplar] Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Representative CDS sequence Show only first row Show all	>Lus10038818 pacid=23150585 polypeptide=Lus10038818 locus=Lus10038818.g ID=Lus10038818.BGIv1.0 annot-version=v1.0 ATGAATCAAGACAGAAATGGAGCTGCTGCTGCGGCGACGACGAATGGATTAGAGAGCGAGTACATTAGGAGACACCATAGCCATGATCCTGACGAGCTTC AGTGCAGCTCCGTTCTGGTTAAGCACATCAGAGCTCCGATCCATCTGGTGTGGTCTCTAGTTAGAAGATTCGATGAGCCACAGAAGTACAAGCCATTCAT CAGCAGATGTGTGGCTGCTCCAGGAAACCTCGAAATCGGCAGCCTTCGAGAGATCGATGTAAAGTCCGGCCTTCCAGCTACTACCAGCACCGAGAGACTA GAGGTCCTCAACGACGAAGAACACATCCTCAGCATGCGCATCATTGGTGGCGATCACAGGCTAAAGAACTACTCGTCTATCGTCTCCTTACACCCGGAGA TCAATGAAGGAAGGCCCGGGACGCTAGTGATTGAGTCATTCGTCGTGGATGTGCCAAATGGGAACTCGAAAGACGAGACTTGCTTCTTCGTGGAAGCCCT GATCAAGTGCAACCTGACTTCGCTCGCTGATGTGTCTGAGAGACTTGCGGTACAAGACATGACTGAGCCTATCGACAGAGTATGTGGACTTGAAGAAGCT GCTGCTACTGCAATGGCTGAGGATGAGGTTTGCAGCAGAGCTCCCCTCTTGTAA
AA sequence Show only first row Show all	>Lus10038818 pacid=23150585 polypeptide=Lus10038818 locus=Lus10038818.g ID=Lus10038818.BGIv1.0 annot-version=v1.0 MNQDRNGAAAAATTNGLESEYIRRHHSHDPDELQCSSVLVKHIRAPIHLVWSLVRRFDEPQKYKPFISRCVAAPGNLEIGSLREIDVKSGLPATTSTERL EVLNDEEHILSMRIIGGDHRLKNYSSIVSLHPEINEGRPGTLVIESFVVDVPNGNSKDETCFFVEALIKCNLTSLADVSERLAVQDMTEPIDRVCGLEEA AATAMAEDEVCSRAPLL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G53160		RCAR3, PYL8	PYR1-like 8, regulatory compon...		Lus10038818 [exp]	0	1
AT5G53160		RCAR3, PYL8	PYR1-like 8, regulatory compon...		Lus10014929 [exp]	1.0	0.8489
AT5G15460		MUB2	membrane-anchored ubiquitin-fo...		Lus10013190 [exp]	2.4	0.7943
AT1G79660			unknown protein		Lus10041631 [exp]	6.3	0.7505
AT4G03420			Protein of unknown function (D...		Lus10031632 [exp]	7.6	0.7199
AT5G52580			RabGAP/TBC domain-containing p...		Lus10006646 [exp]	8.8	0.7834
AT5G12240			unknown protein		Lus10036054 [exp]	9.7	0.7282
AT2G11520		CRCK3	calmodulin-binding receptor-li...		Lus10028347 [exp]	11.7	0.7869
AT5G39590			TLD-domain containing nucleola...		Lus10012406 [exp]	13.0	0.7370
AT2G06530		VPS2.1	SNF7 family protein (.1)		Lus10017166 [exp]	14.6	0.7888
AT1G14290		SBH2	sphingoid base hydroxylase 2 (...		Lus10012832 [exp]	16.4	0.7421

Compare expression of checked genes

Lus10038818 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.