Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G53190 59 / 2e-11 SWEET3, AtSWEET3 Nodulin MtN3 family protein (.1) AT3G14770 53 / 2e-09 SWEET2, AtSWEET2 Nodulin MtN3 family protein (.1) AT1G66770 45 / 2e-06 SWEET6, AtSWEET6 Nodulin MtN3 family protein (.1) AT5G13170 44 / 4e-06 SAG29, SWEET15, AtSWEET15 senescence-associated gene 29 (.1) AT5G50800 43 / 1e-05 SWEET13, AtSWEET13 Nodulin MtN3 family protein (.1) AT4G25010 42 / 1e-05 SWEET14, AtSWEET14 Nodulin MtN3 family protein (.1) AT3G16690 42 / 3e-05 SWEET16, AtSWEET16 Nodulin MtN3 family protein (.1) AT5G23660 41 / 3e-05 MTN3, SWEET12, AtSWEET12 homolog of Medicago truncatula MTN3 (.1) AT2G39060 41 / 4e-05 SWEET9, AtSWEET9 Nodulin MtN3 family protein (.1) AT5G50790 41 / 6e-05 SWEET10, AtSWEET10 Nodulin MtN3 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014932 [exp] 145 / 1e-44 AT5G53190 295 / 6e-101 Nodulin MtN3 family protein (.1) Lus10005935 [exp] 54 / 1e-09 AT5G50800 235 / 3e-76 Nodulin MtN3 family protein (.1) Lus10040901 [exp] 52 / 1e-08 AT5G13170 236 / 8e-77 senescence-associated gene 29 (.1) Lus10024770 [exp] 50 / 2e-08 AT5G23660 259 / 4e-86 homolog of Medicago truncatula MTN3 (.1) Lus10009782 [exp] 50 / 3e-08 AT5G23660 261 / 8e-87 homolog of Medicago truncatula MTN3 (.1) Lus10015754 [exp] 47 / 4e-07 AT5G13170 289 / 7e-98 senescence-associated gene 29 (.1) Lus10000310 [exp] 47 / 6e-07 AT5G13170 295 / 3e-100 senescence-associated gene 29 (.1) Lus10032553 [exp] 47 / 7e-07 AT5G50790 279 / 9e-94 Nodulin MtN3 family protein (.1) Lus10023249 [exp] 45 / 2e-06 AT5G50790 246 / 2e-81 Nodulin MtN3 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G031400 [exp] 90 / 3e-23 AT5G53190 310 / 3e-107 Nodulin MtN3 family protein (.1) Potri.015G021900 [exp] 82 / 3e-20 AT5G53190 286 / 9e-98 Nodulin MtN3 family protein (.1) Potri.001G383000 [exp] 52 / 4e-09 AT3G14770 251 / 1e-84 Nodulin MtN3 family protein (.1) Potri.015G101600 [exp] 52 / 4e-09 AT5G50790 276 / 1e-92 Nodulin MtN3 family protein (.1) Potri.005G187300 [exp] 50 / 2e-08 AT1G21460 365 / 6e-129 Nodulin MtN3 family protein (.1) Potri.015G101700 [exp] 49 / 6e-08 AT5G23660 312 / 3e-107 homolog of Medicago truncatula MTN3 (.1) Potri.011G103600 [exp] 47 / 3e-07 AT3G14770 232 / 7e-77 Nodulin MtN3 family protein (.1) Potri.012G103200 [exp] 47 / 3e-07 AT5G50790 230 / 1e-74 Nodulin MtN3 family protein (.1) Potri.015G101500 [exp] 47 / 4e-07 AT5G50790 291 / 6e-99 Nodulin MtN3 family protein (.1) Potri.019G030500 [exp] 47 / 5e-07 AT2G39060 272 / 3e-92 Nodulin MtN3 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0141 [flax] [poplar] MtN3-like PF03083 [flax] [poplar] MtN3_slv Sugar efflux transporter for intercellular exchange
Representative CDS sequence Show only first row Show all	>Lus10038821 pacid=23150387 polypeptide=Lus10038821 locus=Lus10038821.g ID=Lus10038821.BGIv1.0 annot-version=v1.0 ATGGGAGACAGATTGCAGTTGGCAGTTGGAATCATGGAAGTGATGCAGACAAAAAGCGTGGAGTTCATGCCATTCTACTTGTCGCTCTTCTCGTTGCTCG CGAGCTCTCTGTGGCTCGCCTATGGCTTATTGGGCCATGATTACTTCATTGCATCCCCGAATTTTGTTGGCAGTCCATTGGGGATCCTCCAGCTTGTGCT GTACTGTAGGTACAGAAAGAAAGGGATTGCAGAAGAGCCTACTAACAAATGGGATTTAGAACAGAATGACGGCATCAAGTCTACCACACAGTTGCAGGTC ATGGTTATTGAAGAAGTTAAAGACAAGAACTGA
AA sequence Show only first row Show all	>Lus10038821 pacid=23150387 polypeptide=Lus10038821 locus=Lus10038821.g ID=Lus10038821.BGIv1.0 annot-version=v1.0 MGDRLQLAVGIMEVMQTKSVEFMPFYLSLFSLLASSLWLAYGLLGHDYFIASPNFVGSPLGILQLVLYCRYRKKGIAEEPTNKWDLEQNDGIKSTTQLQV MVIEEVKDKN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G53190		SWEET3, AtSWEET...	Nodulin MtN3 family protein (....		Lus10038821 [exp]	0	1

Compare expression of checked genes

Lus10038821 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.