Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27950 65 / 3e-13 AP2_ERF CRF4 cytokinin response factor 4 (.1) AT4G11140 57 / 2e-10 AP2_ERF CRF1 cytokinin response factor 1 (.1) AT4G23750 54 / 4e-09 AP2_ERF TMO3, CRF2 TARGET OF MONOPTEROS 3, cytokinin response factor 2 (.1.2) AT1G71130 52 / 4e-09 AP2_ERF CRF8 cytokinin response factor 8, Integrase-type DNA-binding superfamily protein (.1) AT2G46310 51 / 2e-08 AP2_ERF CRF5 cytokinin response factor 5 (.1) AT5G53290 47 / 6e-07 AP2_ERF CRF3 cytokinin response factor 3 (.1) AT1G22985 40 / 0.0001 AP2_ERF CRF7 cytokinin response factor 7, Integrase-type DNA-binding superfamily protein (.1) AT1G43160 40 / 0.0001 AP2_ERF RAP2.6, RAP2.06 related to AP2 6 (.1) AT1G68550 40 / 0.0002 AP2_ERF CRF10 cytokinin response factor 10, Integrase-type DNA-binding superfamily protein (.1.2) AT5G61890 40 / 0.0002 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027573 [exp] 89 / 1e-21 AT4G27950 209 / 1e-64 cytokinin response factor 4 (.1) Lus10039324 [exp] 79 / 6e-18 AT4G27950 210 / 8e-65 cytokinin response factor 4 (.1) Lus10017550 [exp] 62 / 5e-12 AT4G23750 172 / 2e-51 TARGET OF MONOPTEROS 3, cytokinin response factor 2 (.1.2) Lus10033938 [exp] 61 / 2e-11 AT4G23750 201 / 6e-62 TARGET OF MONOPTEROS 3, cytokinin response factor 2 (.1.2) Lus10032353 [exp] 60 / 2e-11 AT4G23750 207 / 2e-64 TARGET OF MONOPTEROS 3, cytokinin response factor 2 (.1.2) Lus10005149 [exp] 50 / 5e-08 AT4G27950 106 / 6e-28 cytokinin response factor 4 (.1) Lus10018756 [exp] 45 / 7e-06 AT1G64280 506 / 2e-170 SALICYLIC ACID INSENSITIVE 1, NON-INDUCIBLE IMMUNITY 1, ARABIDOPSIS NONEXPRESSER OF PR GENES 1, regulatory protein (NPR1) (.1) Lus10014054 [exp] 42 / 5e-05 AT4G34410 139 / 4e-40 redox responsive transcription factor 1 (.1) Lus10005805 [exp] 40 / 0.0003 AT5G61890 120 / 4e-32 Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G032900 [exp] 72 / 2e-15 AT4G27950 214 / 6e-67 cytokinin response factor 4 (.1) Potri.015G023200 [exp] 67 / 6e-14 AT4G27950 211 / 9e-66 cytokinin response factor 4 (.1) Potri.002G167400 [exp] 59 / 7e-11 AT4G27950 162 / 3e-47 cytokinin response factor 4 (.1) Potri.014G094500 [exp] 58 / 9e-11 AT2G46310 163 / 3e-48 cytokinin response factor 5 (.1) Potri.003G136300 [exp] 56 / 1e-09 AT4G11140 160 / 1e-46 cytokinin response factor 1 (.1) Potri.001G094800 [exp] 54 / 3e-09 AT4G23750 177 / 2e-52 TARGET OF MONOPTEROS 3, cytokinin response factor 2 (.1.2) Potri.019G131300 [exp] 50 / 8e-08 AT4G27950 139 / 2e-38 cytokinin response factor 4 (.1) Potri.013G158500 [exp] 41 / 9e-05 AT4G27950 124 / 1e-32 cytokinin response factor 4 (.1) Potri.008G186300 [exp] 41 / 0.0001 AT1G24590 69 / 1e-12 FOR SUPPRESSOR OF PHYTOCHROMEB-4 2, ENHANCER OF SHOOT REGENERATION 2, DORNROSCHEN-like (.1) Potri.012G108500 [exp] 40 / 0.0003 AT5G61890 144 / 3e-42 Integrase-type DNA-binding superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10038826 pacid=23150272 polypeptide=Lus10038826 locus=Lus10038826.g ID=Lus10038826.BGIv1.0 annot-version=v1.0 ATGGCTGATCCGAGTTTTCTCAGCCGGACGAAGTTCTCGAAGCACCGGAGTCAAGTCAGAAAGTACGCTCCCAAGCCGCCGGCGAAACGGAAGACGGAAA AACACCCTTTGCCTCCGGCGGTGACGGCGGCGGAGGAGTTGGGTCGGAAAGTGTCCACCCGGGTGGTGAGGATATCGGTGACTGACCCGGATGCGACGGA CTCCTCCAGCGACGAGGAAGCGGAGGTGTTCGGGATGATCAAGAGGTCCGAAAACGAGTACAACAGCGAGAGAAAAACGACGGAGGTGCGGCGTACGGCG GCGGTGGGTGGTGCTCAGGGTGTGAAGAAGTTTAGGGGAGTTAGGCAGCGGCCATGGGGGAAGTGGGCGGCTGTCTCCTACTTCGGTTCTTCAGTTCAGG AACCAATCGAGTGA
AA sequence Show only first row Show all	>Lus10038826 pacid=23150272 polypeptide=Lus10038826 locus=Lus10038826.g ID=Lus10038826.BGIv1.0 annot-version=v1.0 MADPSFLSRTKFSKHRSQVRKYAPKPPAKRKTEKHPLPPAVTAAEELGRKVSTRVVRISVTDPDATDSSSDEEAEVFGMIKRSENEYNSERKTTEVRRTA AVGGAQGVKKFRGVRQRPWGKWAAVSYFGSSVQEPIE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G27950	AP2_ERF	CRF4	cytokinin response factor 4 (....		Lus10038826 [exp]	0	1
AT4G32720		ATLA1	La protein 1 (.1.2)		Lus10022135 [exp]	9.9	0.9080
AT1G80530			Major facilitator superfamily ...		Lus10017480 [exp]	11.7	0.9177
AT2G01830		CRE1, AHK4, WOL...	WOODEN LEG 1, WOODEN LEG, CYTO...		Lus10028992 [exp]	19.0	0.9132
AT4G12080	AT-hook	ATAHL1, AHL1	AT-hook motif nuclear-localize...		Lus10002841 [exp]	20.0	0.9011
AT1G80530			Major facilitator superfamily ...		Lus10028803 [exp]	24.5	0.9022
AT2G20470			AGC (cAMP-dependent, cGMP-depe...		Lus10033911 [exp]	25.7	0.9004
AT3G04770		RPSAB	40s ribosomal protein SA B (.1...		Lus10040626 [exp]	27.6	0.9061
AT4G25320	AT-hook		AT hook motif DNA-binding fami...		Lus10031118 [exp]	31.3	0.9041
AT4G00360		ATT1, CYP86A2	"cytochrome P450, family 86, s...		Lus10014768 [exp]	35.7	0.8606
AT5G66860			Ribosomal protein L25/Gln-tRNA...		Lus10019634 [exp]	36.5	0.8928

Compare expression of checked genes

Lus10038826 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.