Lus10038829 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G53330 183 / 4e-58 Ubiquitin-associated/translation elongation factor EF1B protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014944 325 / 4e-114 AT5G53330 210 / 6e-69 Ubiquitin-associated/translation elongation factor EF1B protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G023600 221 / 3e-73 AT5G53330 216 / 3e-71 Ubiquitin-associated/translation elongation factor EF1B protein (.1)
Potri.012G033300 221 / 4e-73 AT5G53330 192 / 8e-62 Ubiquitin-associated/translation elongation factor EF1B protein (.1)
PFAM info
Representative CDS sequence
>Lus10038829 pacid=23150683 polypeptide=Lus10038829 locus=Lus10038829.g ID=Lus10038829.BGIv1.0 annot-version=v1.0
ATGGATTACGACTACAGAAACCGATCCAACTCGCCTTACGATCCTCAGATCCCGAACTACAACAGATCACCCACCTCATCTTCGTCCGCTCATCCGATGT
ACGGAGCTCCTGCTTACCCGAGAGTCGGCGGTGGATACGGCGGAGCTCCTCCCGTCGGCCGCCACCCCTCTTACCATCAGAACTCGGCTCCTCCGCCGTC
TTCTTCTTCTGCCTCTGGGTTGGGGATCCGAGTGGCCTTGAAGCCTGAGTACCGTATCTCGCCGCCGCCTCAACTATTGCCGATGAGAGAGGTTCCGCGT
AGCAATTTCCAGTTCGATTTCGAGTTTGAGCGGAAGCTGTTAGCTGAGGCGGAGAAAGGGGAGATCAACTGGAGCAGGCTAGGTATGGATAATTTGCCTC
CTAAGGCTACTGAATCGACTTCTTCTTCATCGGGTTCAGGTGGCGATCCTGTAGTGAGCAAATACATTGCTGCCGGACTTAATCGAGAAGCTGTTCCTGT
TGCAGTTGCCAACTACGGAGATAACCCGACAAAGGTTCAAGAATTCGCCAAGGGTTACACCCTACTACGAGAAATGGGATTCTCATCGAACAATGTAGCT
GAAGCGCTCCTCATGAATGACAACGACACAGACAAGGCATTGGCGCATTTCCTTAACAGTCCTTCATAA
AA sequence
>Lus10038829 pacid=23150683 polypeptide=Lus10038829 locus=Lus10038829.g ID=Lus10038829.BGIv1.0 annot-version=v1.0
MDYDYRNRSNSPYDPQIPNYNRSPTSSSSAHPMYGAPAYPRVGGGYGGAPPVGRHPSYHQNSAPPPSSSSASGLGIRVALKPEYRISPPPQLLPMREVPR
SNFQFDFEFERKLLAEAEKGEINWSRLGMDNLPPKATESTSSSSGSGGDPVVSKYIAAGLNREAVPVAVANYGDNPTKVQEFAKGYTLLREMGFSSNNVA
EALLMNDNDTDKALAHFLNSPS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G53330 Ubiquitin-associated/translati... Lus10038829 0 1
AT5G35200 ENTH/ANTH/VHS superfamily prot... Lus10038122 1.0 0.9429
AT4G36945 PLC-like phosphodiesterases su... Lus10000092 2.0 0.9339
AT4G24290 MAC/Perforin domain-containing... Lus10010894 7.1 0.9096
AT1G61240 Protein of unknown function (D... Lus10006728 8.4 0.8904
AT1G54710 ATATG18H homolog of yeast autophagy 18 ... Lus10033818 8.7 0.8857
AT5G53330 Ubiquitin-associated/translati... Lus10014944 9.2 0.8868
AT1G21380 Target of Myb protein 1 (.1) Lus10029739 14.7 0.9052
AT1G20110 RING/FYVE/PHD zinc finger supe... Lus10013571 15.0 0.8772
AT5G01960 RING/U-box superfamily protein... Lus10011027 15.7 0.8671
AT2G31390 STH pfkB-like carbohydrate kinase ... Lus10009526 17.9 0.9017

Lus10038829 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.