Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G52850 68 / 6e-15 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G22070 54 / 7e-10 pentatricopeptide (PPR) repeat-containing protein (.1) AT2G03880 45 / 1e-06 REME1 required for efficiency of mitochondrial editing 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G13650 45 / 1e-06 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G49170 44 / 2e-06 EMB2261 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G27610 43 / 4e-06 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G14170 43 / 4e-06 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G41080 42 / 8e-06 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G22410 42 / 8e-06 SLO1 SLOW GROWTH 1 (.1) AT3G49710 42 / 8e-06 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014950 [exp] 155 / 2e-45 AT5G52850 683 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10022890 [exp] 48 / 7e-08 AT3G61170 865 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10025490 [exp] 46 / 4e-07 AT2G33760 734 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10024936 [exp] 46 / 4e-07 AT3G61170 855 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10008967 [exp] 45 / 6e-07 AT4G21300 876 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10028855 [exp] 45 / 1e-06 AT4G21300 873 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10031989 [exp] 45 / 1e-06 AT3G26782 865 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10016425 [exp] 44 / 2e-06 AT2G22070 1002 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Lus10008637 [exp] 44 / 2e-06 AT5G03800 902 / 0.0 embryo defective 1899, EMBRYO DEFECTIVE 175, EMBRYO DEFECTIVE 166, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G071800 [exp] 72 / 2e-16 AT5G52850 803 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.013G058900 [exp] 49 / 3e-08 AT4G13650 1282 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.016G096400 [exp] 49 / 5e-08 AT5G03800 993 / 0.0 embryo defective 1899, EMBRYO DEFECTIVE 175, EMBRYO DEFECTIVE 166, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.002G155100 [exp] 47 / 1e-07 AT3G61170 933 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G237000 [exp] 45 / 6e-07 AT5G66520 544 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.003G081700 [exp] 45 / 1e-06 AT4G16835 852 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.011G052300 [exp] 44 / 2e-06 AT2G33760 747 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.003G006800 [exp] 44 / 2e-06 AT3G16610 687 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Potri.001G322100 [exp] 44 / 3e-06 AT3G26782 897 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.001G019500 [exp] 44 / 3e-06 AT2G22410 791 / 0.0 SLOW GROWTH 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10038834 pacid=23150654 polypeptide=Lus10038834 locus=Lus10038834.g ID=Lus10038834.BGIv1.0 annot-version=v1.0 ATGTTGGCTGCTTGCAGAGTTCATAAGAATCTGCGGCTTGGAGAAGATATGGCGAGGAGAGGTCTCGGGATTTGTCCCAAGGATCCGGTGTTCTACGTTT GGCTTGCTAAGCTGTACAATGAATGCGATAGACCCGATTTGGCTGAGCAGACTAGGAAGTCGAAGAGGGATAGGTTTTCTTGGGTCGAACCGGTTGAATT AAGGGAACAAGACTGGTCTGTCCCAAAAATGAGGCATGTTGTTTTGGGTTATACCTGA
AA sequence Show only first row Show all	>Lus10038834 pacid=23150654 polypeptide=Lus10038834 locus=Lus10038834.g ID=Lus10038834.BGIv1.0 annot-version=v1.0 MLAACRVHKNLRLGEDMARRGLGICPKDPVFYVWLAKLYNECDRPDLAEQTRKSKRDRFSWVEPVELREQDWSVPKMRHVVLGYT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G52850			Pentatricopeptide repeat (PPR)...		Lus10038834 [exp]	0	1
					Lus10024012 [exp]	2.8	0.8244
AT1G62510			Bifunctional inhibitor/lipid-t...		Lus10001493 [exp]	3.0	0.8261
AT5G06210			RNA binding (RRM/RBD/RNP motif...		Lus10004224 [exp]	6.3	0.7223
AT3G46570			Glycosyl hydrolase superfamily...		Lus10000070 [exp]	7.7	0.7725
					Lus10019512 [exp]	7.7	0.7443
					Lus10015336 [exp]	14.8	0.7408
AT4G26830			O-Glycosyl hydrolases family 1...		Lus10011852 [exp]	25.0	0.6493
AT1G11410			S-locus lectin protein kinase ...		Lus10007610 [exp]	26.5	0.6937
					Lus10003479 [exp]	26.8	0.7284
AT5G06920		FLA21	FASCICLIN-like arabinogalactan...		Lus10016437 [exp]	28.0	0.6855

Compare expression of checked genes

Lus10038834 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.