Lus10038841 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G25680 313 / 9e-109 PPPDE putative thiol peptidase family protein (.1)
AT4G25660 309 / 6e-107 PPPDE putative thiol peptidase family protein (.1)
AT2G25190 95 / 2e-23 PPPDE putative thiol peptidase family protein (.1)
AT5G25170 87 / 7e-21 PPPDE putative thiol peptidase family protein (.1)
AT1G80690 84 / 1e-19 PPPDE putative thiol peptidase family protein (.1)
AT1G47740 85 / 2e-19 PPPDE putative thiol peptidase family protein (.1.2)
AT5G47310 84 / 4e-19 PPPDE putative thiol peptidase family protein (.1)
AT4G17486 82 / 1e-18 PPPDE putative thiol peptidase family protein (.1.2)
AT4G31980 84 / 2e-18 unknown protein
AT3G07090 52 / 8e-08 PPPDE putative thiol peptidase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014960 426 / 1e-153 AT4G25680 341 / 1e-119 PPPDE putative thiol peptidase family protein (.1)
Lus10027510 374 / 2e-132 AT4G25680 346 / 3e-121 PPPDE putative thiol peptidase family protein (.1)
Lus10039275 370 / 8e-131 AT4G25680 348 / 6e-122 PPPDE putative thiol peptidase family protein (.1)
Lus10017127 98 / 5e-25 AT5G25170 312 / 3e-109 PPPDE putative thiol peptidase family protein (.1)
Lus10018326 97 / 1e-24 AT5G25170 314 / 3e-110 PPPDE putative thiol peptidase family protein (.1)
Lus10007844 92 / 2e-22 AT4G17486 277 / 3e-95 PPPDE putative thiol peptidase family protein (.1.2)
Lus10004755 90 / 7e-22 AT4G17486 273 / 2e-93 PPPDE putative thiol peptidase family protein (.1.2)
Lus10005341 88 / 5e-21 AT5G25170 303 / 9e-106 PPPDE putative thiol peptidase family protein (.1)
Lus10040170 87 / 8e-21 AT4G17486 283 / 9e-98 PPPDE putative thiol peptidase family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G143132 357 / 6e-126 AT4G25680 331 / 2e-115 PPPDE putative thiol peptidase family protein (.1)
Potri.004G079800 353 / 2e-124 AT4G25680 339 / 1e-118 PPPDE putative thiol peptidase family protein (.1)
Potri.018G021700 95 / 2e-23 AT5G25170 301 / 2e-104 PPPDE putative thiol peptidase family protein (.1)
Potri.006G261500 94 / 2e-23 AT5G25170 313 / 5e-109 PPPDE putative thiol peptidase family protein (.1)
Potri.003G080300 90 / 8e-22 AT5G47310 295 / 9e-102 PPPDE putative thiol peptidase family protein (.1)
Potri.001G047800 88 / 4e-21 AT1G80690 298 / 2e-103 PPPDE putative thiol peptidase family protein (.1)
Potri.003G180400 87 / 1e-20 AT1G80690 303 / 1e-105 PPPDE putative thiol peptidase family protein (.1)
Potri.001G154400 87 / 2e-20 AT5G47310 308 / 4e-107 PPPDE putative thiol peptidase family protein (.1)
Potri.009G113168 81 / 5e-18 AT1G47740 335 / 6e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.T126004 80 / 8e-18 AT1G47740 337 / 2e-117 PPPDE putative thiol peptidase family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF05903 Peptidase_C97 PPPDE putative peptidase domain
Representative CDS sequence
>Lus10038841 pacid=23150542 polypeptide=Lus10038841 locus=Lus10038841.g ID=Lus10038841.BGIv1.0 annot-version=v1.0
ATGACGGATGTCGTATTGCACATATACGACGTGACAAACAGTGGATCGGAGAAGACGAACAGTACGATCATGCAGATCAACAAGATCTTCAAGGACGGAA
TCGGCATCGGAGGCATCTTCCACAGTGCTGTTCAGGTATATGGAGAAGATGAGTGGTCTTTCGGTTTCTGTGAACGAGGAACCGGAGTGTTCAGTTGCCC
TTCTGGAAAGAATCCAATGTATACATACCGTGAAAGCATCATCCTTGGCAAAACTAGCTTCTCAATCTCTAAAGTGAACCAGATCCTGCGCGAATTCAGT
AGGGAATGGCCTGGAAATGCTTATGATTTGTTGGCCAAGAACTGTAATCACTTTTGTGATGAGTTCTGTGAGAAGTTAGGTGTACCGAAGCTTCCAGGTT
GGGTTAACCGGTTTGCCAATGCTGGTGATGCAGCTGTCGAAATAGCTGGAAACACTGCCGTACGATTTAGGCAAGCAAAAACCGAGATCTTAACAGCTAG
TAAAGTAGCCTATCGTTTCCTGTTGGGCGTTGGATCCAACAACGGTACTACTGGCAACTCTCCTGGCAACTCCTCTGGGTCTCCAAGGATTCAAGCAACT
TGGTTCAAGAACCTCGTCACCAATGGTGCGAAACCATCTACCAGTACAGAGATCGACTCTCCGCAACAGCAGAAGAAGTCTCGACAGGAGCTGTCGGATA
AGCTTCTTTTATCATGA
AA sequence
>Lus10038841 pacid=23150542 polypeptide=Lus10038841 locus=Lus10038841.g ID=Lus10038841.BGIv1.0 annot-version=v1.0
MTDVVLHIYDVTNSGSEKTNSTIMQINKIFKDGIGIGGIFHSAVQVYGEDEWSFGFCERGTGVFSCPSGKNPMYTYRESIILGKTSFSISKVNQILREFS
REWPGNAYDLLAKNCNHFCDEFCEKLGVPKLPGWVNRFANAGDAAVEIAGNTAVRFRQAKTEILTASKVAYRFLLGVGSNNGTTGNSPGNSSGSPRIQAT
WFKNLVTNGAKPSTSTEIDSPQQQKKSRQELSDKLLLS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G25680 PPPDE putative thiol peptidase... Lus10038841 0 1
AT3G25910 Protein of unknown function (D... Lus10019436 8.1 0.9246
AT4G30340 ATDGK7 diacylglycerol kinase 7 (.1) Lus10015514 17.9 0.9211
AT1G64230 UBC28 ubiquitin-conjugating enzyme 2... Lus10038827 18.8 0.9190
AT4G16520 ATG8F autophagy 8f, Ubiquitin-like s... Lus10000733 19.1 0.9230
AT4G25680 PPPDE putative thiol peptidase... Lus10014960 19.5 0.8773
AT3G57870 SCE1A, SCE1, AH... SUMO CONJUGATING ENZYME 1A, EM... Lus10009376 21.9 0.9206
AT1G44770 unknown protein Lus10034500 26.7 0.9211
AT3G51100 unknown protein Lus10041813 27.2 0.8911
AT1G11905 B-cell receptor-associated pro... Lus10020025 31.8 0.9187
AT3G51100 unknown protein Lus10028362 32.2 0.8880

Lus10038841 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.