Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G25590 232 / 2e-80 ADF7 actin depolymerizing factor 7 (.1) AT5G52360 226 / 1e-77 ADF10 actin depolymerizing factor 10 (.1) AT1G01750 220 / 1e-75 ADF11 actin depolymerizing factor 11 (.1) AT4G00680 216 / 9e-74 ADF8 actin depolymerizing factor 8 (.1) AT3G46000 214 / 3e-73 ADF2 actin depolymerizing factor 2 (.1) AT5G59890 211 / 4e-72 ADF4, ATADF4 actin depolymerizing factor 4 (.1.2) AT3G46010 209 / 3e-71 ATADF1, ADF1 actin depolymerizing factor 1 (.1.2) AT5G59880 202 / 2e-68 ADF3 actin depolymerizing factor 3 (.1.2) AT2G31200 165 / 1e-53 ADF6, ATADF6 actin depolymerizing factor 6 (.1) AT2G16700 162 / 2e-52 ADF5, ATADF5 actin depolymerizing factor 5 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014977 [exp] 268 / 2e-94 AT4G25590 233 / 1e-80 actin depolymerizing factor 7 (.1) Lus10027474 [exp] 247 / 4e-86 AT5G52360 244 / 6e-85 actin depolymerizing factor 10 (.1) Lus10039229 [exp] 247 / 4e-86 AT5G52360 231 / 6e-80 actin depolymerizing factor 10 (.1) Lus10024418 [exp] 217 / 4e-74 AT5G59890 249 / 6e-87 actin depolymerizing factor 4 (.1.2) Lus10024417 [exp] 212 / 3e-72 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2) Lus10025319 [exp] 212 / 3e-72 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2) Lus10023428 [exp] 213 / 2e-69 AT5G59890 244 / 4e-81 actin depolymerizing factor 4 (.1.2) Lus10040307 [exp] 209 / 1e-68 AT5G59890 243 / 2e-81 actin depolymerizing factor 4 (.1.2) Lus10008489 [exp] 177 / 2e-58 AT1G01750 192 / 2e-64 actin depolymerizing factor 11 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G141600 [exp] 231 / 7e-80 AT4G25590 254 / 5e-89 actin depolymerizing factor 7 (.1) Potri.015G144500 [exp] 229 / 3e-79 AT4G25590 257 / 6e-90 actin depolymerizing factor 7 (.1) Potri.001G236700 [exp] 225 / 3e-77 AT5G59890 256 / 2e-89 actin depolymerizing factor 4 (.1.2) Potri.008G052100 [exp] 224 / 5e-77 AT5G59890 249 / 1e-86 actin depolymerizing factor 4 (.1.2) Potri.009G028100 [exp] 223 / 8e-77 AT5G59890 256 / 1e-89 actin depolymerizing factor 4 (.1.2) Potri.001G106200 [exp] 221 / 7e-76 AT4G00680 234 / 6e-81 actin depolymerizing factor 8 (.1) Potri.009G028200 [exp] 219 / 3e-75 AT5G59890 258 / 4e-90 actin depolymerizing factor 4 (.1.2) Potri.001G236400 [exp] 219 / 6e-75 AT5G59890 246 / 1e-85 actin depolymerizing factor 4 (.1.2) Potri.003G125500 [exp] 215 / 2e-73 AT4G00680 234 / 1e-80 actin depolymerizing factor 8 (.1) Potri.010G208500 [exp] 214 / 3e-73 AT5G59890 255 / 4e-89 actin depolymerizing factor 4 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0092 [flax] [poplar] ADF PF00241 [flax] [poplar] Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Representative CDS sequence Show only first row Show all	>Lus10038859 pacid=23150520 polypeptide=Lus10038859 locus=Lus10038859.g ID=Lus10038859.BGIv1.0 annot-version=v1.0 ATGGCAGTCCACGACGACTGTAAACTCAAGTTTCTGGAGCTGAAATCGAAGAGGAACTACAGGTTCATCGTGTTCAAGATCGAGAACCAGCAGGTTATCG TTGAGAAGCTCGGTTTGGCTAACGAGTCTTACGAGGATTTCACCTCTTCCCTTCCTGCTAACGAGTGCCGATATGCTGTCTATGACTTCGACTTCACCAC CGACGAGAACTGCCACAAGAGCAAGATCTTCTTCATCGCATGGGCGCCCGATACATCCAAGGTGAGGAGCAAAATGGTGTATGCAAGCTCGAAGGACAGA TTCAAAAGGGAACTTGACGGGATCCAAGTAGAGTTGCAGGCTACCGATCCGAGTGAAATGAGCCTCGACATTGTCAAAGGCCGAGCCCTCTAA
AA sequence Show only first row Show all	>Lus10038859 pacid=23150520 polypeptide=Lus10038859 locus=Lus10038859.g ID=Lus10038859.BGIv1.0 annot-version=v1.0 MAVHDDCKLKFLELKSKRNYRFIVFKIENQQVIVEKLGLANESYEDFTSSLPANECRYAVYDFDFTTDENCHKSKIFFIAWAPDTSKVRSKMVYASSKDR FKRELDGIQVELQATDPSEMSLDIVKGRAL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G25590		ADF7	actin depolymerizing factor 7 ...		Lus10038859 [exp]	0	1

Compare expression of checked genes

Lus10038859 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.