Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G47790 49 / 5e-08 F-box and associated interaction domains-containing protein (.1) AT1G30790 46 / 4e-07 F-box and associated interaction domains-containing protein (.1) AT1G47765 46 / 7e-07 F-box and associated interaction domains-containing protein (.1) AT1G50870 44 / 2e-06 F-box and associated interaction domains-containing protein (.1) AT3G10240 44 / 2e-06 F-box and associated interaction domains-containing protein (.1) AT1G19160 44 / 3e-06 F-box family protein (.1) AT1G32420 43 / 6e-06 F-box and associated interaction domains-containing protein (.1) AT1G33530 43 / 7e-06 F-box family protein (.1) AT1G52490 43 / 8e-06 unknown protein AT1G50880 42 / 1e-05 F-box and associated interaction domains-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014984 [exp] 137 / 4e-43 AT1G33530 46 / 1e-06 F-box family protein (.1) Lus10014979 [exp] 74 / 8e-17 AT1G33530 57 / 6e-09 F-box family protein (.1) Lus10016866 [exp] 67 / 3e-14 AT1G32420 84 / 2e-17 F-box and associated interaction domains-containing protein (.1) Lus10034309 [exp] 67 / 3e-14 AT4G38870 84 / 4e-18 F-box and associated interaction domains-containing protein (.1) Lus10011197 [exp] 67 / 4e-14 AT1G47790 86 / 6e-18 F-box and associated interaction domains-containing protein (.1) Lus10011200 [exp] 66 / 5e-14 AT1G47790 84 / 2e-18 F-box and associated interaction domains-containing protein (.1) Lus10007277 [exp] 63 / 9e-13 AT3G04660 82 / 6e-17 F-box and associated interaction domains-containing protein (.1) Lus10007285 [exp] 63 / 9e-13 AT3G04660 82 / 7e-17 F-box and associated interaction domains-containing protein (.1) Lus10041462 [exp] 61 / 9e-13 AT1G30790 47 / 3e-07 F-box and associated interaction domains-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G093100 [exp] 51 / 9e-09 AT1G50870 80 / 2e-16 F-box and associated interaction domains-containing protein (.1) Potri.014G162600 [exp] 51 / 1e-08 AT3G07870 467 / 9e-164 F-box and associated interaction domains-containing protein (.1) Potri.001G318300 [exp] 50 / 2e-08 AT3G06240 140 / 7e-38 F-box family protein (.1) Potri.006G012900 [exp] 50 / 3e-08 AT4G12560 144 / 2e-39 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.008G199601 [exp] 47 / 3e-08 AT3G06240 61 / 2e-12 F-box family protein (.1) Potri.001G458400 [exp] 49 / 5e-08 AT2G31470 113 / 8e-28 DROUGHT TOLERANCE REPRESSOR, F-box and associated interaction domains-containing protein (.1) Potri.006G170300 [exp] 49 / 5e-08 AT4G12560 69 / 1e-12 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.001G318400 [exp] 48 / 9e-08 AT3G06240 142 / 3e-38 F-box family protein (.1) Potri.001G035500 [exp] 47 / 2e-07 AT4G12560 271 / 3e-87 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.012G014700 [exp] 47 / 3e-07 AT1G12170 66 / 1e-11 F-box family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10038864 pacid=23150324 polypeptide=Lus10038864 locus=Lus10038864.g ID=Lus10038864.BGIv1.0 annot-version=v1.0 ATGGACGAAGATCTGGTGGTTTCCGACATACTCACGAGGCTCCCGGTGAGGTCGCTGATGCGGTTCAAGTGCGTCTCCAAAGGTTGGTTCCCCATCGTCG AGACAGATCCGCACTTCATCGATTTACACCGCATTCTTGGGTCGATACGAGAAAGGAAACCTACTCTTGCTGTTATCACCACCTCTTTTACGGCCAAGAA TCACGTGGTGGAAATGATCCTCCCCGCCGGCGAAGGGGAAGGTGTTGGGATTAGAGAGCTCGAACTACCTATCTCGAGACGACGAGATTGA
AA sequence Show only first row Show all	>Lus10038864 pacid=23150324 polypeptide=Lus10038864 locus=Lus10038864.g ID=Lus10038864.BGIv1.0 annot-version=v1.0 MDEDLVVSDILTRLPVRSLMRFKCVSKGWFPIVETDPHFIDLHRILGSIRERKPTLAVITTSFTAKNHVVEMILPAGEGEGVGIRELELPISRRRD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G47790			F-box and associated interacti...		Lus10038864 [exp]	0	1
AT5G23880		ATCPSF100, EMB1...	ENHANCED SILENCING PHENOTYPE 5...		Lus10035061 [exp]	10.7	0.8654
AT5G06680		ATSPC98, SPC98,...	ARABIDOPSIS THALIANA GAMMA TUB...		Lus10029296 [exp]	13.0	0.8580
AT3G44600		AtCYP71, CYP71	cyclophilin 71, cyclophilin71 ...		Lus10020573 [exp]	19.3	0.8589
AT1G31660			unknown protein		Lus10032891 [exp]	27.5	0.8503
AT2G40430			unknown protein		Lus10011462 [exp]	28.7	0.8462
AT3G16490		IQD26	IQ-domain 26 (.1)		Lus10043033 [exp]	32.9	0.8517
AT3G59670			unknown protein		Lus10008349 [exp]	42.4	0.8442
AT5G56900	C3HZnF		CwfJ-like family protein / zin...		Lus10021589 [exp]	50.7	0.8362
AT5G25757			RNA polymerase I-associated fa...		Lus10037897 [exp]	55.6	0.8409
AT5G26230		MAKR1	membrane-associated kinase reg...		Lus10041214 [exp]	61.8	0.8176

Compare expression of checked genes

Lus10038864 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.