Lus10038866 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G25570 243 / 2e-81 ACYB-2 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT5G38630 150 / 4e-45 ACYB-1 cytochrome B561-1 (.1)
AT1G26100 104 / 2e-27 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT1G14730 93 / 5e-23 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014986 335 / 1e-116 AT4G25570 331 / 8e-115 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10039216 287 / 1e-98 AT4G25570 305 / 6e-106 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10027461 270 / 1e-91 AT4G25570 287 / 3e-98 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10003076 129 / 3e-37 AT5G38630 281 / 2e-97 cytochrome B561-1 (.1)
Lus10034074 128 / 1e-35 AT5G38630 287 / 7e-98 cytochrome B561-1 (.1)
Lus10034427 108 / 1e-28 AT1G14730 280 / 4e-96 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10031935 106 / 5e-28 AT1G14730 284 / 8e-98 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10021715 89 / 3e-21 AT1G26100 241 / 3e-80 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10028996 87 / 2e-20 AT4G25570 145 / 4e-43 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G143700 273 / 3e-93 AT4G25570 297 / 8e-103 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.012G141000 265 / 4e-90 AT4G25570 254 / 5e-86 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.017G111700 160 / 1e-48 AT5G38630 321 / 2e-112 cytochrome B561-1 (.1)
Potri.004G103800 158 / 3e-48 AT5G38630 301 / 2e-104 cytochrome B561-1 (.1)
Potri.008G115300 147 / 1e-43 AT5G38630 272 / 7e-93 cytochrome B561-1 (.1)
Potri.008G138300 110 / 2e-29 AT1G14730 252 / 2e-85 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.010G131100 108 / 7e-29 AT1G26100 270 / 6e-92 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.010G102400 108 / 9e-29 AT1G14730 271 / 7e-93 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.008G115200 102 / 2e-26 AT1G26100 270 / 6e-92 Cytochrome b561/ferric reductase transmembrane protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0328 2heme_cytochrom PF03188 Cytochrom_B561 Eukaryotic cytochrome b561
Representative CDS sequence
>Lus10038866 pacid=23150313 polypeptide=Lus10038866 locus=Lus10038866.g ID=Lus10038866.BGIv1.0 annot-version=v1.0
ATGGGTTTAGGTGTAAAGGCGTTACCTTTCACTTACGTGGCGCATGCGATCGCCGTGGTGGCTGCGGTCATGGTTCTGATCTGGTGCATTAGCTTCAGAG
GCGGCTTAGCTTGGGAAGATACCAACAAAAACCTCATCTTCAACCTTCATCCAGTGCTGATGCTAATCGGCCTTATAATCATAGGAGGTGAAGCAATCAT
AAGCTACAAGTCACTGCCACTGGAGAAAGAAACGAAGAAGCTGATCCACCTGGCCCTCCACGCTGTCGCGCTCGTTCTAGGCATCGTCGGGATCTACACT
GCTTTCAAGTTCCATAACGAGAGCGGCATTGCCAATCTCTACAGCTTGCACTCCTGGCTCGGCATCCTCGTCATCTCCCTCTACGGTATCCAGTGGATCT
ACGGCTTCGTAATCTTCTTCTACCCGGGTGGATCGAGCACCCTGCGGAGCGCATCCCTGCCCTGGCACGTCCTACTCGGCCTCTTCGCGTACATACTAGG
CGTTGGAACCGCAGCCCTCGGGTTCCTCGAGAAGCTAACCTTCCTCGAGAACTCGGGGCTCGCCAAGTACGGGTCTGAAGCCCTGCTCGTGAACTTAACC
GCAGTGGTCACGATTCTGTACGGCGCATTCGTCATACTGTCAGTGCTCGGGGATCGGACCCCGGCTCAGGATGACTACAGCTACTCGGCTATATGA
AA sequence
>Lus10038866 pacid=23150313 polypeptide=Lus10038866 locus=Lus10038866.g ID=Lus10038866.BGIv1.0 annot-version=v1.0
MGLGVKALPFTYVAHAIAVVAAVMVLIWCISFRGGLAWEDTNKNLIFNLHPVLMLIGLIIIGGEAIISYKSLPLEKETKKLIHLALHAVALVLGIVGIYT
AFKFHNESGIANLYSLHSWLGILVISLYGIQWIYGFVIFFYPGGSSTLRSASLPWHVLLGLFAYILGVGTAALGFLEKLTFLENSGLAKYGSEALLVNLT
AVVTILYGAFVILSVLGDRTPAQDDYSYSAI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G25570 ACYB-2 Cytochrome b561/ferric reducta... Lus10038866 0 1
AT4G25570 ACYB-2 Cytochrome b561/ferric reducta... Lus10014986 1.4 0.8815
AT3G02910 AIG2-like (avirulence induced ... Lus10040635 1.7 0.8946
AT3G57990 unknown protein Lus10012013 2.0 0.8611
AT1G17100 SOUL heme-binding family prote... Lus10042093 3.9 0.8695
AT2G43250 unknown protein Lus10040469 4.2 0.8491
AT1G67350 unknown protein Lus10015785 6.6 0.8213
AT3G06170 Serinc-domain containing serin... Lus10004430 7.3 0.8353
AT3G57340 Heat shock protein DnaJ, N-ter... Lus10030079 7.7 0.8538
Lus10017659 8.7 0.7910
AT1G71180 6-phosphogluconate dehydrogena... Lus10001349 9.2 0.8445

Lus10038866 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.