Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G52220 129 / 1e-39 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014990 [exp] 198 / 2e-66 AT5G52220 89 / 2e-23 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G140200 [exp] 148 / 7e-47 AT5G52220 112 / 2e-32 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF09696 [flax] [poplar] Ctf8 Ctf8
Representative CDS sequence Show only first row Show all	>Lus10038870 pacid=23150489 polypeptide=Lus10038870 locus=Lus10038870.g ID=Lus10038870.BGIv1.0 annot-version=v1.0 ATGCAGATTGAGGTGAAGTGTACGTGCGGATCGGAGAACTGTCCGGAGTGGGCGATCGTGGAGCTCCAAGGCGTCGTCGAAGTGCAGCCGTCGTTTCACG ACAAGATCCAGAACCTGGAAATCGGCCGCCTCTGCCGCCCTTCCTCCGACGACAAATACACGCTCACGATCGGCTACCACGAGCTCTCCGGGAGTAAAGT CGCATTGAAGAAGCCTCTTGCTGTTATGAAGAAGGTGAATCGGATCGACGACGACGGGAAGGTGGAGCTCGACGTTGTAGGGGTCATTCGTCACAAGATC CAGTTCAAAACCAGACCTAAGGCCCTTATCACCAAAACTGAGCCGGTGGTGAAGGATCGAGTCAAGAAAGCTGCGAGTTCTTCCGAGATGTAA
AA sequence Show only first row Show all	>Lus10038870 pacid=23150489 polypeptide=Lus10038870 locus=Lus10038870.g ID=Lus10038870.BGIv1.0 annot-version=v1.0 MQIEVKCTCGSENCPEWAIVELQGVVEVQPSFHDKIQNLEIGRLCRPSSDDKYTLTIGYHELSGSKVALKKPLAVMKKVNRIDDDGKVELDVVGVIRHKI QFKTRPKALITKTEPVVKDRVKKAASSSEM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G52220			unknown protein		Lus10038870 [exp]	0	1
AT4G18590			Nucleic acid-binding, OB-fold-...		Lus10014209 [exp]	1.4	0.9245
AT1G21880		LYM1	lysm domain GPI-anchored prote...		Lus10018191 [exp]	2.6	0.9249
AT4G28310			unknown protein		Lus10018597 [exp]	4.0	0.9088
AT3G03590			SWIB/MDM2 domain superfamily p...		Lus10005667 [exp]	7.7	0.8984
AT3G46320			Histone superfamily protein (....		Lus10019956 [exp]	7.9	0.9125
AT5G43250	CCAAT	NF-YC13	"nuclear factor Y, subunit C13...		Lus10030657 [exp]	8.1	0.9049
AT2G27970		CKS2	CDK-subunit 2 (.1)		Lus10016159 [exp]	8.4	0.8947
AT3G18630		ATUNG	uracil dna glycosylase (.1)		Lus10012898 [exp]	13.9	0.8907
AT4G35880			Eukaryotic aspartyl protease f...		Lus10028410 [exp]	15.0	0.8755
AT1G78560			Sodium Bile acid symporter fam...		Lus10013700 [exp]	17.7	0.8828

Compare expression of checked genes

Lus10038870 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.