Lus10038878 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G04630 209 / 8e-71 NRPE6B, NRPB6B RNA polymerase Rpb6 (.1)
AT5G51940 208 / 2e-70 NRPE6A, NRPD6A, NRPB6A RNA polymerase Rpb6 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015000 284 / 2e-100 AT2G04630 209 / 9e-71 RNA polymerase Rpb6 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G138800 239 / 1e-82 AT5G51940 197 / 7e-66 RNA polymerase Rpb6 (.1)
Potri.012G136900 199 / 5e-67 AT5G51940 210 / 4e-71 RNA polymerase Rpb6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01192 RNA_pol_Rpb6 RNA polymerase Rpb6
Representative CDS sequence
>Lus10038878 pacid=23150251 polypeptide=Lus10038878 locus=Lus10038878.g ID=Lus10038878.BGIv1.0 annot-version=v1.0
ATGGCGGACGACGATTACAACGAAATGGACATGGGATACGAGGACGAGCCAGCTGAGCCCGATGTCGAGGAAGGAGCCGAACCAGAGGCGGATAACGAGA
ACGGCGAGGATGTCACAGGGGAACCCATTGAAACGGATGACAGGGGGGATCCGGATGCAGTGGAGAGATCAGCTCGGAAGACGTCCAAGTATATGACCAA
GTACGAGCGTGCCAGGATTTTGGGGACCCGGGCTCTGCAGATCAGCATGAATGCTCCTGTCATGGTGGAGTTGGAGGGTGAGACTGATCCATTGGAGATC
GCCATGAAGGAGCTTCGACAGCGAAAGATTCCTTTCACCATCCGCCGGTACCTGCCTGATGGAAGCTACGAAGACTGGGGAGTCGACGAGCTGATCGTCG
AAGACTCGTGGAAGAGGCAGGTCGGAGGGGACTAA
AA sequence
>Lus10038878 pacid=23150251 polypeptide=Lus10038878 locus=Lus10038878.g ID=Lus10038878.BGIv1.0 annot-version=v1.0
MADDDYNEMDMGYEDEPAEPDVEEGAEPEADNENGEDVTGEPIETDDRGDPDAVERSARKTSKYMTKYERARILGTRALQISMNAPVMVELEGETDPLEI
AMKELRQRKIPFTIRRYLPDGSYEDWGVDELIVEDSWKRQVGGD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G04630 NRPE6B, NRPB6B RNA polymerase Rpb6 (.1) Lus10038878 0 1
AT2G04630 NRPE6B, NRPB6B RNA polymerase Rpb6 (.1) Lus10015000 2.2 0.9248
AT5G56670 Ribosomal protein S30 family p... Lus10017473 3.7 0.9175
AT5G12080 ATMSL10, MSL10 mechanosensitive channel of sm... Lus10011954 5.1 0.8441
AT2G35736 unknown protein Lus10028935 8.9 0.8653
AT4G29430 RPS15AE ribosomal protein S15A E (.1) Lus10000975 9.9 0.8953
AT5G40080 Mitochondrial ribosomal protei... Lus10003002 12.4 0.8802
Lus10027105 13.1 0.8046
AT4G20150 unknown protein Lus10036250 13.2 0.8770
AT3G10090 Nucleic acid-binding, OB-fold-... Lus10016222 13.6 0.8922
AT3G07590 Small nuclear ribonucleoprotei... Lus10028022 16.0 0.8606

Lus10038878 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.