Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G45650 150 / 1e-45 MADS AGL6 AGAMOUS-like 6 (.1) AT5G60910 142 / 2e-42 MADS FUL, AGL8 FRUITFULL, AGAMOUS-like 8 (.1.2) AT1G24260 139 / 3e-41 MADS AGL9, SEP3 SEPALLATA3, AGAMOUS-like 9, K-box region and MADS-box transcription factor family protein (.1.2.3) AT4G09960 137 / 8e-41 MADS AGL11, STK SEEDSTICK, AGAMOUS-like 11, K-box region and MADS-box transcription factor family protein (.1.2.3.4) AT1G69120 138 / 1e-40 MADS AGL7, AP1 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1) AT3G02310 137 / 2e-40 MADS AGL4, SEP2 SEPALLATA 2, AGAMOUS-like 4, K-box region and MADS-box transcription factor family protein (.1) AT5G15800 137 / 3e-40 MADS AGL2, SEP1 SEPALLATA1, AGAMOUS-like 2, K-box region and MADS-box transcription factor family protein (.1.2) AT3G61120 136 / 3e-40 MADS AGL13 AGAMOUS-like 13 (.1) AT1G26310 136 / 6e-40 MADS CAL1, AGL10, CAL CAULIFLOWER, AGAMOUS-like 10, K-box region and MADS-box transcription factor family protein (.1) AT2G03710 132 / 4e-39 MADS AGL3, SEP4 SEPALLATA 4, AGAMOUS-like 3, K-box region and MADS-box transcription factor family protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015017 [exp] 268 / 1e-92 AT2G45650 174 / 1e-54 AGAMOUS-like 6 (.1) Lus10026678 [exp] 141 / 2e-42 AT5G15800 225 / 3e-74 SEPALLATA1, AGAMOUS-like 2, K-box region and MADS-box transcription factor family protein (.1.2) Lus10003125 [exp] 140 / 2e-42 AT1G24260 290 / 9e-101 SEPALLATA3, AGAMOUS-like 9, K-box region and MADS-box transcription factor family protein (.1.2.3) Lus10017871 [exp] 139 / 3e-42 AT1G69120 264 / 2e-90 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1) Lus10007983 [exp] 142 / 4e-42 AT5G60910 298 / 3e-102 FRUITFULL, AGAMOUS-like 8 (.1.2) Lus10004638 [exp] 141 / 4e-42 AT3G02310 246 / 2e-82 SEPALLATA 2, AGAMOUS-like 4, K-box region and MADS-box transcription factor family protein (.1) Lus10021140 [exp] 141 / 6e-42 AT5G60910 291 / 1e-99 FRUITFULL, AGAMOUS-like 8 (.1.2) Lus10026679 [exp] 140 / 1e-41 AT1G69120 338 / 1e-118 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1) Lus10003124 [exp] 140 / 2e-41 AT1G24260 355 / 6e-125 SEPALLATA3, AGAMOUS-like 9, K-box region and MADS-box transcription factor family protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G134800 [exp] 172 / 6e-54 AT2G45650 209 / 2e-67 AGAMOUS-like 6 (.1) Potri.012G132600 [exp] 160 / 1e-49 AT2G45650 182 / 3e-57 AGAMOUS-like 6 (.1) Potri.014G074100 [exp] 159 / 4e-49 AT2G45650 311 / 5e-108 AGAMOUS-like 6 (.1) Potri.012G062300 [exp] 148 / 1e-44 AT5G60910 288 / 5e-99 FRUITFULL, AGAMOUS-like 8 (.1.2) Potri.010G154100 [exp] 144 / 5e-43 AT1G69120 324 / 7e-113 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1) Potri.008G098500 [exp] 142 / 2e-42 AT1G69120 336 / 9e-118 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1) Potri.003G169600 [exp] 138 / 5e-41 AT1G24260 359 / 7e-127 SEPALLATA3, AGAMOUS-like 9, K-box region and MADS-box transcription factor family protein (.1.2.3) Potri.004G115500 [exp] 138 / 7e-41 AT3G02310 357 / 4e-126 SEPALLATA 2, AGAMOUS-like 4, K-box region and MADS-box transcription factor family protein (.1) Potri.001G058400 [exp] 137 / 2e-40 AT1G24260 362 / 8e-128 SEPALLATA3, AGAMOUS-like 9, K-box region and MADS-box transcription factor family protein (.1.2.3) Potri.017G099700 [exp] 135 / 1e-39 AT3G02310 372 / 8e-132 SEPALLATA 2, AGAMOUS-like 4, K-box region and MADS-box transcription factor family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01486 [flax] [poplar] K-box K-box region PF00319 [flax] [poplar] SRF-TF SRF-type transcription factor (DNA-binding and dimerisation domain)
Representative CDS sequence Show only first row Show all	>Lus10038895 pacid=23150591 polypeptide=Lus10038895 locus=Lus10038895.g ID=Lus10038895.BGIv1.0 annot-version=v1.0 ATGGGGAGAGGGAAAGTGGTGATGAAGAGGATAGAGAACAAAGTGAACAGACAAGTCACTTTCTCCAAGAGAAGGAACGGCTTGCTCAAGAAAGCCTCAG AGCTCTCTCTTCTCTGCGACTCAGAGGTCGCCCTCATCGTCTTCTCCTGCCGCGGCAAGCTCTCCGCCTTCCCCTCTACAGAAGGTGTTGGAAAAACCCT AGTGAGGTATAAACAATACCACTACAACAACCAGCAACAAGGCAGCCACAGGAGTACTAATACTGATGCTGAGAATGGATCAACAATTCAGAGCTTGTGC CTAGAGGTGACCAAGCTGAAAGAGAAATGTGAATCACTTCAAAAGTCTCACAGGCATTGCCAAGGAGAAGACATCGAGAAGCTTAGTGCCAAAGAGTTGA TGAAGATTGAGAGGAAGCTTGATAGGGCTCTATCCCGGGCTAGGCAAAAGAAGGAACAAGATCTTGGAGCAGAAAACAAGCAGCTTCTTGAGCTAAAGGA TGGAGTGCTACAAAATCATGAAGGTGATGGAAACAGGGGCTACTAG
AA sequence Show only first row Show all	>Lus10038895 pacid=23150591 polypeptide=Lus10038895 locus=Lus10038895.g ID=Lus10038895.BGIv1.0 annot-version=v1.0 MGRGKVVMKRIENKVNRQVTFSKRRNGLLKKASELSLLCDSEVALIVFSCRGKLSAFPSTEGVGKTLVRYKQYHYNNQQQGSHRSTNTDAENGSTIQSLC LEVTKLKEKCESLQKSHRHCQGEDIEKLSAKELMKIERKLDRALSRARQKKEQDLGAENKQLLELKDGVLQNHEGDGNRGY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G45650	MADS	AGL6	AGAMOUS-like 6 (.1)		Lus10038895 [exp]	0	1
AT1G75290			NAD(P)-binding Rossmann-fold s...		Lus10035058 [exp]	9.4	0.9284
					Lus10034743 [exp]	13.3	0.9284
AT5G22480			ZPR1 zinc-finger domain protei...		Lus10037351 [exp]	16.2	0.9284
					Lus10003536 [exp]	18.8	0.9284
AT4G17220		ATMAP70-5	microtubule-associated protein...		Lus10003908 [exp]	21.0	0.9284
					Lus10009727 [exp]	23.0	0.9284
					Lus10011078 [exp]	24.8	0.9284
AT1G08510		FATB	fatty acyl-ACP thioesterases B...		Lus10025763 [exp]	26.5	0.9284
AT3G02100			UDP-Glycosyltransferase superf...		Lus10015750 [exp]	28.1	0.9284
AT4G13090		XTH2	xyloglucan endotransglucosylas...		Lus10032879 [exp]	29.7	0.9284

Compare expression of checked genes

Lus10038895 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.