Lus10038907 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G51570 493 / 2e-178 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT5G62740 325 / 6e-112 AtHIR4, ATHIR1 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT3G01290 321 / 2e-110 AtHIR2 hypersensitive induced reaction 2, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT1G69840 303 / 2e-103 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1.2.3.4.5.6.7)
AT5G54100 56 / 7e-09 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT4G27585 53 / 7e-08 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015032 549 / 0 AT5G51570 532 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10007268 325 / 8e-112 AT5G62740 510 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10033099 325 / 9e-112 AT5G62740 533 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10015356 323 / 3e-111 AT5G62740 506 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10004268 308 / 2e-105 AT5G62740 535 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10037213 302 / 4e-103 AT1G69840 514 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1.2.3.4.5.6.7)
Lus10036715 302 / 7e-103 AT1G69840 516 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1.2.3.4.5.6.7)
Lus10032909 56 / 9e-09 AT4G27585 498 / 4e-176 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10015597 47 / 7e-06 AT4G27585 383 / 7e-130 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G129000 496 / 2e-179 AT5G51570 480 / 4e-173 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.015G130600 494 / 9e-179 AT5G51570 510 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.017G078100 322 / 9e-111 AT5G62740 488 / 3e-176 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.017G078000 312 / 8e-107 AT5G62740 518 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.012G070500 306 / 8e-105 AT5G62740 484 / 3e-175 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.015G065001 179 / 2e-55 AT5G62740 312 / 4e-108 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.015G001900 52 / 2e-07 AT4G27585 499 / 2e-176 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.012G005500 49 / 1e-06 AT4G27585 463 / 3e-162 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.012G009800 49 / 2e-06 AT4G27585 382 / 3e-130 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0433 SPFH PF01145 Band_7 SPFH domain / Band 7 family
Representative CDS sequence
>Lus10038907 pacid=23150308 polypeptide=Lus10038907 locus=Lus10038907.g ID=Lus10038907.BGIv1.0 annot-version=v1.0
ATGGGGAATGCGTTCTGCGTCTTCTGCGGATGCGTTGATCAAGCGAGCATCGGCATAGTGGAGCGATGGGGCCGGTTCGAGAGATTGGCCGAGCCAGGTC
TTCACTTCTTCAACCCCTTCGTTGGCCAGTGCCTCTCCGGGATTCTGTCCACCAGGATCCAGTCGCTCGACGTTCGCGTCGAGACCAAAACGAAGGACAA
TGTGTTTGTGCAATTGGTTTGCTCCATTCAATACCGGGTCGTGAAAGCAAATGCTGATGATGCTTTCTACGAGCTGGCGAATCCTCAAGAGCAGATTCAG
GCCTATGTGTTTGATGTGGTTCGAGCTATTGTTCCTCGGATGACGTTGGATGAGCTCTTTGAACAGAAGGGAGAGGTCGCTAAGGCAGTATTGGAGGAAC
TCGAGAAGGTAATGGGTGCTTACGGGTACAACATAGAGCATATCCTGATGGTTGACATTATACCGGATCCCTCTGTGCGCAAGGCTATGAACGAGATCAA
CGCAGCTCAAAGGCTCCAGCTTGCCAGCGTATACAAAGGCGAAGCGGAGAAGATACTCTTAGTCAAGAAGGCAGAGGCCGAAGCTGAGGCCAAGTACCTT
GGAGGAGTCGGTGTCGCCAAGCAGAGGCAGGCCATTACGGACGGACTTCGAGAGAACATCTTGAACTTCTCAAACACGGTCGAAGGCACGAGTTCCAAGG
AAGTGATGGACCTGATCATGATCACTCAGTACTTCGACACGATCAAGGACCTCGGCAACTCGTCCAAGAACACCACCGTCTTCATCCCCCACGGCCCTGG
CCATGTTCGCGACATCGGCGATCAGATTCGCAATGGTATGATGGAGGCTGCTTGTGCACCGGTGAAGATCGAATGA
AA sequence
>Lus10038907 pacid=23150308 polypeptide=Lus10038907 locus=Lus10038907.g ID=Lus10038907.BGIv1.0 annot-version=v1.0
MGNAFCVFCGCVDQASIGIVERWGRFERLAEPGLHFFNPFVGQCLSGILSTRIQSLDVRVETKTKDNVFVQLVCSIQYRVVKANADDAFYELANPQEQIQ
AYVFDVVRAIVPRMTLDELFEQKGEVAKAVLEELEKVMGAYGYNIEHILMVDIIPDPSVRKAMNEINAAQRLQLASVYKGEAEKILLVKKAEAEAEAKYL
GGVGVAKQRQAITDGLRENILNFSNTVEGTSSKEVMDLIMITQYFDTIKDLGNSSKNTTVFIPHGPGHVRDIGDQIRNGMMEAACAPVKIE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G51570 SPFH/Band 7/PHB domain-contain... Lus10038907 0 1
AT4G33440 Pectin lyase-like superfamily ... Lus10014799 2.4 0.8622
AT3G52430 PAD4, ATPAD4 ARABIDOPSIS PHYTOALEXIN DEFICI... Lus10039617 6.5 0.8411
AT3G15510 NAC ATNAC2, ANAC056... NAC-REGULATED SEED MORPHOLOGY ... Lus10032657 7.0 0.8355
Lus10033310 7.6 0.8603
AT2G46550 unknown protein Lus10023163 8.4 0.8458
AT2G01620 MEE11 maternal effect embryo arrest ... Lus10007930 8.5 0.8526
AT3G50930 BCS1 cytochrome BC1 synthesis (.1) Lus10041918 8.7 0.8040
AT5G51570 SPFH/Band 7/PHB domain-contain... Lus10015032 11.7 0.8466
AT3G57810 Cysteine proteinases superfami... Lus10028840 11.9 0.7812
AT4G25230 RIN2 RPM1 interacting protein 2 (.1... Lus10031152 12.0 0.8245

Lus10038907 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.