Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G62300 209 / 1e-71 Ribosomal protein S10p/S20e family protein (.1.2) AT3G45030 209 / 1e-71 Ribosomal protein S10p/S20e family protein (.1) AT3G47370 209 / 2e-71 Ribosomal protein S10p/S20e family protein (.1.2.3) AT3G13120 55 / 3e-10 Ribosomal protein S10p/S20e family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031705 [exp] 230 / 1e-79 AT5G62300 211 / 5e-72 Ribosomal protein S10p/S20e family protein (.1.2) Lus10027194 [exp] 229 / 4e-79 AT5G62300 207 / 2e-70 Ribosomal protein S10p/S20e family protein (.1.2) Lus10031126 [exp] 216 / 2e-74 AT3G45030 207 / 2e-70 Ribosomal protein S10p/S20e family protein (.1) Lus10031706 [exp] 214 / 2e-73 AT3G45030 202 / 7e-69 Ribosomal protein S10p/S20e family protein (.1) Lus10031125 [exp] 120 / 9e-37 AT5G62300 113 / 6e-34 Ribosomal protein S10p/S20e family protein (.1.2) Lus10016604 [exp] 57 / 9e-11 AT3G13120 240 / 3e-81 Ribosomal protein S10p/S20e family protein (.1.2) Lus10007111 [exp] 55 / 1e-09 AT3G13120 226 / 3e-75 Ribosomal protein S10p/S20e family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G129800 [exp] 206 / 9e-70 AT5G62300 223 / 9e-77 Ribosomal protein S10p/S20e family protein (.1.2) Potri.012G128300 [exp] 203 / 4e-69 AT5G62300 222 / 2e-76 Ribosomal protein S10p/S20e family protein (.1.2) Potri.002G146600 [exp] 195 / 7e-66 AT3G47370 204 / 1e-69 Ribosomal protein S10p/S20e family protein (.1.2.3) Potri.002G116900 [exp] 118 / 4e-36 AT3G47370 125 / 4e-39 Ribosomal protein S10p/S20e family protein (.1.2.3) Potri.001G365600 [exp] 56 / 1e-10 AT3G13120 237 / 4e-80 Ribosomal protein S10p/S20e family protein (.1.2) Potri.011G092800 [exp] 56 / 2e-10 AT3G13120 231 / 1e-77 Ribosomal protein S10p/S20e family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00338 [flax] [poplar] Ribosomal_S10 Ribosomal protein S10p/S20e
Representative CDS sequence Show only first row Show all	>Lus10038910 pacid=23150282 polypeptide=Lus10038910 locus=Lus10038910.g ID=Lus10038910.BGIv1.0 annot-version=v1.0 ATGGCGACATACGCAGCCAAGCATGCGAAGGCAGGGCTAGAAGAGCCAGAGAACCAAATCCACAAGATCAGGATCACTCTCAGCTCCAAGAATGTGAAGA ACCTCGAGAAAGTCTGTGGAGACTTGATTCGTGGAGCTAAGGATAAGATGTTGAGGGTGAAGGGACCAGTCAGGATGCCTACCAAGACTCTGCTTATCAC CACTAGGAAGTCTCCTTGTGGAGAAGGAACAAACACTTTTGACAGATTCGAGCTGCGAGTCCACAAGCGTGTGATTGACCTCTTCAGCTCCCCGGATGTG GTGAAGCAGATCACCTCGATTACAATCGAGCCCGGTGTTGAGGTCGAAGTCACCATCGCCGACCCTTAA
AA sequence Show only first row Show all	>Lus10038910 pacid=23150282 polypeptide=Lus10038910 locus=Lus10038910.g ID=Lus10038910.BGIv1.0 annot-version=v1.0 MATYAAKHAKAGLEEPENQIHKIRITLSSKNVKNLEKVCGDLIRGAKDKMLRVKGPVRMPTKTLLITTRKSPCGEGTNTFDRFELRVHKRVIDLFSSPDV VKQITSITIEPGVEVEVTIADP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G62300			Ribosomal protein S10p/S20e fa...		Lus10038910 [exp]	0	1
AT4G29390			Ribosomal protein S30 family p...		Lus10002508 [exp]	1.0	0.9021
AT3G61110		ARS27A	ribosomal protein S27 (.1)		Lus10031974 [exp]	4.0	0.8704
AT1G18800		NRP2	NAP1-related protein 2 (.1)		Lus10023599 [exp]	4.9	0.8423
AT5G04800			Ribosomal S17 family protein (...		Lus10021307 [exp]	5.5	0.8433
AT4G39200			Ribosomal protein S25 family p...		Lus10035060 [exp]	5.5	0.8554
AT1G77940			Ribosomal protein L7Ae/L30e/S1...		Lus10027926 [exp]	6.3	0.8488
AT2G30260		U2B''	U2 small nuclear ribonucleopro...		Lus10026413 [exp]	7.3	0.8300
AT1G14620		XTR2, EXGT-A2, ...	decoy (.1.2)		Lus10012875 [exp]	7.5	0.8335
AT1G26910		RPL10B	ribosomal protein L10 B, Ribos...		Lus10031002 [exp]	10.2	0.8380
AT3G58660			Ribosomal protein L1p/L10e fam...		Lus10024134 [exp]	10.6	0.7995

Compare expression of checked genes

Lus10038910 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.