Lus10038914 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G62350 192 / 9e-63 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G47380 183 / 5e-59 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G25260 171 / 2e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G12390 163 / 4e-51 PME1 pectin methylesterase inhibitor 1 (.1)
AT1G62770 160 / 4e-50 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62360 153 / 4e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G20740 137 / 8e-41 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT2G01610 135 / 6e-40 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G62760 135 / 5e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G14890 132 / 1e-38 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027198 332 / 1e-117 AT5G62350 191 / 3e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031133 227 / 3e-76 AT5G62350 211 / 8e-70 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031713 218 / 1e-72 AT5G62350 202 / 4e-66 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10032230 167 / 2e-52 AT1G62770 166 / 9e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10024593 153 / 3e-47 AT1G62770 162 / 2e-50 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031711 151 / 2e-46 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031138 144 / 2e-43 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031132 137 / 5e-41 AT1G62760 135 / 3e-40 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038915 134 / 2e-39 AT5G62360 174 / 5e-55 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G128700 224 / 3e-75 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.012G127500 220 / 9e-74 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G113700 176 / 3e-56 AT4G12390 178 / 1e-56 pectin methylesterase inhibitor 1 (.1)
Potri.015G128300 158 / 2e-49 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128100 156 / 3e-48 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128200 151 / 1e-46 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.012G127400 144 / 9e-44 AT4G25250 150 / 7e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.008G132600 138 / 4e-41 AT1G14890 216 / 1e-71 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.001G119300 138 / 4e-41 AT1G62760 167 / 3e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128400 137 / 7e-41 AT5G62360 134 / 2e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10038914 pacid=23150452 polypeptide=Lus10038914 locus=Lus10038914.g ID=Lus10038914.BGIv1.0 annot-version=v1.0
ATGGCGACCAACCCCAATTCCCAAACCCTCTTCCTAACAATCTCCACCCTCCTCCTCACCACAACCGCCGCCGCCGACTTCATCAAAACCTCCTGCGCCG
CCACAACATACCCAGCCCTCTGCATCCACTCGCTCACACCCTACGCGCCATCCATCAAAACCTCCACGGGCCGCCTGGCCATCACGGCCTTAACAGTCAG
CCTCTCCACCGCCCAATCGACGAAATCCTACGTCCGCAAGCTGCAGCCGTCCAAGCCGAGGGAAGCCGCCGCCGTGAAGGACTGCGCCGAGGAGATCGAG
GACACCGTGGACCGGCTGAGCCGGTCGATCAAGGAGCTGAAGGCGATGGGCGCGAGTGGGGAGGAGTTCCAGTGGCATTTGAGTAATATCGAGACGTGGG
TCAGCGCTGCGTTGACCGACGAGAATACTTGTGTTGACGGATTTGGTGGGAAAGTGATGGATGGGGAGATGAAGGATGCGATAAGGGTTAGGTTTCTGAG
GACTGCTAGAGTTACTAGTAATGCTCTGGCTTTGATTAACAAGTTTGGCCGCCGCCATTGA
AA sequence
>Lus10038914 pacid=23150452 polypeptide=Lus10038914 locus=Lus10038914.g ID=Lus10038914.BGIv1.0 annot-version=v1.0
MATNPNSQTLFLTISTLLLTTTAAADFIKTSCAATTYPALCIHSLTPYAPSIKTSTGRLAITALTVSLSTAQSTKSYVRKLQPSKPREAAAVKDCAEEIE
DTVDRLSRSIKELKAMGASGEEFQWHLSNIETWVSAALTDENTCVDGFGGKVMDGEMKDAIRVRFLRTARVTSNALALINKFGRRH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G62350 Plant invertase/pectin methyle... Lus10038914 0 1
AT3G02645 Plant protein of unknown funct... Lus10026964 1.7 0.8678
AT1G74160 unknown protein Lus10034677 4.9 0.8131
AT1G74160 unknown protein Lus10017857 5.3 0.8430
AT4G11740 SAY1 Ubiquitin-like superfamily pro... Lus10041365 5.5 0.8251
AT1G70180 Sterile alpha motif (SAM) doma... Lus10014516 5.9 0.7480
AT1G30820 CTP synthase family protein (.... Lus10038403 9.2 0.8073
AT3G54920 PMR6 powdery mildew resistant 6, Pe... Lus10037945 9.8 0.8013
AT4G38470 STY46 serine/threonine/tyrosine kina... Lus10022653 10.5 0.7666
AT5G13100 unknown protein Lus10015761 13.3 0.7957
AT2G30933 Carbohydrate-binding X8 domain... Lus10031443 16.1 0.7676

Lus10038914 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.