Lus10038915 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G62360 149 / 1e-45 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G62760 139 / 3e-40 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62350 117 / 8e-33 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G14890 112 / 5e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G25260 111 / 9e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT2G01610 107 / 1e-28 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G62770 105 / 2e-28 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G25250 99 / 5e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G47380 99 / 8e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G51520 98 / 2e-25 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027199 259 / 7e-89 AT5G62360 169 / 3e-53 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031138 154 / 3e-47 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10028910 134 / 4e-39 AT1G62760 169 / 1e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031717 133 / 7e-39 AT5G62360 179 / 3e-57 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031133 129 / 1e-37 AT5G62350 211 / 8e-70 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031713 127 / 5e-37 AT5G62350 202 / 4e-66 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10004327 124 / 2e-35 AT1G62760 164 / 8e-50 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031711 122 / 8e-35 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038914 118 / 2e-33 AT5G62350 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G128200 170 / 1e-53 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128300 164 / 2e-51 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128100 159 / 2e-49 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G113600 127 / 5e-37 AT1G62760 171 / 1e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.012G127500 126 / 1e-36 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128700 123 / 2e-35 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.001G119300 120 / 4e-34 AT1G62760 167 / 3e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.012G127400 115 / 2e-32 AT4G25250 150 / 7e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G113700 113 / 3e-31 AT4G12390 178 / 1e-56 pectin methylesterase inhibitor 1 (.1)
Potri.015G128400 110 / 4e-30 AT5G62360 134 / 2e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10038915 pacid=23150598 polypeptide=Lus10038915 locus=Lus10038915.g ID=Lus10038915.BGIv1.0 annot-version=v1.0
ATGGCATCAACTTCCTCCTCCTCAGCCGCCGCCGCCGCATTCCTCACGATCCTACTAATCTCCTCCACCACCACCGTCACCTCATCCCGCGCCGCCACCA
CAAACACCGAGTTCATCCGGACATCATGCACGGCCACAACCTACCCAAAGCTCTGCTACGCCTCCCTATCAACCCAAGCCGCCAAAATCCAGTCAAGCTC
CAAACTCCTCGCCGCCGCCGCCCTAGACGTCACCCTCACCTCCGTGAAATTCGCGTCCGCCGCCATGTCCAAGCTGTCACATGACCAAGGCCTCCTTCCA
CGTGAGTCTGCCGCCATGAAGGACTGCGTGGAGGAGATGGGCGACTCCGTCGACCAGCTCCGCCGCTCCATCGACGAGTTCGAATCCACGACGACGAAGC
CTGCCGATGTAGAGATGATGATCAGCGACGTGCAGACGTGGGTCAGCGCGGCGTTGACCGACGAGGGCACGTGCATGGACGGGTTTTCGATTTCCGGTAA
GGCGGCGTCGGCGGTGAAGGAGGTTGTGAGAGGGAAGGTGGAGAAGATTGTTCATCTTACTAGTAATGCTCTGGCTTTGGTTAATTGCTATGCTAATTCT
CTTCGTAATTAG
AA sequence
>Lus10038915 pacid=23150598 polypeptide=Lus10038915 locus=Lus10038915.g ID=Lus10038915.BGIv1.0 annot-version=v1.0
MASTSSSSAAAAAFLTILLISSTTTVTSSRAATTNTEFIRTSCTATTYPKLCYASLSTQAAKIQSSSKLLAAAALDVTLTSVKFASAAMSKLSHDQGLLP
RESAAMKDCVEEMGDSVDQLRRSIDEFESTTTKPADVEMMISDVQTWVSAALTDEGTCMDGFSISGKAASAVKEVVRGKVEKIVHLTSNALALVNCYANS
LRN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G62360 Plant invertase/pectin methyle... Lus10038915 0 1
AT2G48150 ATGPX4 glutathione peroxidase 4 (.1) Lus10042692 2.0 0.9162
AT5G57670 Protein kinase superfamily pro... Lus10015516 2.2 0.8524
AT1G80760 NLM7, NIP6;1 NOD26-like intrinsic protein 6... Lus10041674 3.5 0.8537
AT5G05690 CBB3, DWF3, CYP... DWARF 3, CYTOCHROME P450 90A1,... Lus10014850 3.7 0.8875
AT1G80760 NLM7, NIP6;1 NOD26-like intrinsic protein 6... Lus10041675 6.7 0.8245
AT2G40610 ATHEXPALPHA1.11... expansin A8 (.1) Lus10029038 10.5 0.8330
AT1G67623 F-box family protein (.1) Lus10038709 12.0 0.7707
AT4G03140 NAD(P)-binding Rossmann-fold s... Lus10005927 13.3 0.8133
AT5G62360 Plant invertase/pectin methyle... Lus10027199 18.3 0.7910
AT2G28085 SAUR-like auxin-responsive pro... Lus10016129 18.5 0.8190

Lus10038915 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.