Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G25225 81 / 2e-21 unknown protein AT2G35736 77 / 3e-20 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027209 [exp] 115 / 5e-35 AT4G25225 82 / 8e-23 unknown protein Lus10028935 [exp] 75 / 3e-19 AT2G35736 96 / 2e-28 unknown protein Lus10004354 [exp] 74 / 6e-19 AT2G35736 95 / 4e-28 unknown protein Lus10000732 [exp] 56 / 7e-12 AT2G35736 73 / 1e-19 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G124100 [exp] 87 / 8e-24 AT4G25225 90 / 6e-26 unknown protein Potri.001G123000 [exp] 74 / 6e-19 AT2G35736 91 / 1e-26 unknown protein Potri.014G059600 [exp] 72 / 4e-18 AT4G25225 87 / 8e-25 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10038922 pacid=23150652 polypeptide=Lus10038922 locus=Lus10038922.g ID=Lus10038922.BGIv1.0 annot-version=v1.0 ATGTCAGTCCGCCTCAGTTTAATGTTCTCTGAAGCCTTTCATAACCCTCTAAAAAGTTCGCCGGCGAGACTCGAAGCCATCCTTCCCGCCGATCAAGCCA TAATTCGCCGTTTCCCCCGATCCTCTCTTGCCGGAGAACTCGATTCCAGTTTCGAGAACCCTTCAGAACCGATGGGAATAATCCGTACTTACTTCTCCTT CATCGTCGGCACGGTGTCAGGGATCTACATCGCGCAGAACTACGAGGTCCCGAACATCAGGAAGGTTGTGAACTCCGCGCTCTTCACCGCCAAAGTCGTC GAGGAGAAGTATCGGAAGCCCAAGAGTGGTAAAGATGATGTTTAG
AA sequence Show only first row Show all	>Lus10038922 pacid=23150652 polypeptide=Lus10038922 locus=Lus10038922.g ID=Lus10038922.BGIv1.0 annot-version=v1.0 MSVRLSLMFSEAFHNPLKSSPARLEAILPADQAIIRRFPRSSLAGELDSSFENPSEPMGIIRTYFSFIVGTVSGIYIAQNYEVPNIRKVVNSALFTAKVV EEKYRKPKSGKDDV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G25225			unknown protein		Lus10038922 [exp]	0	1
AT5G47890			NADH-ubiquinone oxidoreductase...		Lus10011053 [exp]	10.0	0.7576
AT4G14450		ATBET12	unknown protein		Lus10021208 [exp]	13.0	0.7670
AT1G68070			Zinc finger, C3HC4 type (RING ...		Lus10021801 [exp]	13.1	0.7586
AT4G30440		GAE1	UDP-D-glucuronate 4-epimerase ...		Lus10023213 [exp]	16.1	0.7766
AT2G31305		INH3	inhibitor-3 (.1)		Lus10018105 [exp]	18.3	0.6839
AT3G48240			Octicosapeptide/Phox/Bem1p fam...		Lus10019490 [exp]	25.5	0.7285
AT1G13950		EIF5A, ATELF5A-...	eukaryotic elongation factor 5...		Lus10036801 [exp]	44.0	0.6889
					Lus10039856 [exp]	44.3	0.7173
AT5G16550			unknown protein		Lus10003850 [exp]	44.9	0.7104
AT3G09032			unknown protein		Lus10027777 [exp]	47.1	0.7226

Compare expression of checked genes

Lus10038922 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.