Lus10038928 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G61460 66 / 3e-14 SMC6B, ATRAD18, MIM STRUCTURAL MAINTENANCE OF CHROMOSOMES 6B, hypersensitive to MMS, irradiation and MMC, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G07660 64 / 1e-13 SMC6A structural maintenance of chromosomes 6A (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027219 113 / 8e-31 AT5G61460 1070 / 0.0 STRUCTURAL MAINTENANCE OF CHROMOSOMES 6B, hypersensitive to MMS, irradiation and MMC, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G107700 61 / 2e-12 AT5G61460 1237 / 0.0 STRUCTURAL MAINTENANCE OF CHROMOSOMES 6B, hypersensitive to MMS, irradiation and MMC, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10038928 pacid=23150525 polypeptide=Lus10038928 locus=Lus10038928.g ID=Lus10038928.BGIv1.0 annot-version=v1.0
ATGGGCGACACCGGTTTCGTCCCTGGCTATTCGTGTGCTTCCCCACGAACATCGGGTACTATCAAGAGGATCCGTGTCGAGAATTTCATGTGCCACAGTA
ACCTCCAAATCGAGCTCGGTCCTCGGGTTAACTTCATCACCGGCCAGAACGGAAGTAGGTTTCCGTTTTACCTCTTTCGTTCTTCAGCTCTCTTGTGTGT
TGCTGTCGATTACATCTATCAGTTTCCAATGTAG
AA sequence
>Lus10038928 pacid=23150525 polypeptide=Lus10038928 locus=Lus10038928.g ID=Lus10038928.BGIv1.0 annot-version=v1.0
MGDTGFVPGYSCASPRTSGTIKRIRVENFMCHSNLQIELGPRVNFITGQNGSRFPFYLFRSSALLCVAVDYIYQFPM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G61460 SMC6B, ATRAD18,... STRUCTURAL MAINTENANCE OF CHRO... Lus10038928 0 1
AT1G12700 RPF1 RNA processing factor 1, ATP b... Lus10042768 4.2 0.9016
AT5G58450 Tetratricopeptide repeat (TPR)... Lus10026402 8.8 0.9027
AT1G05570 ATGSL6, ATGSL06... GLUCAN SYNTHASE-LIKE 6, callos... Lus10013744 9.6 0.9037
AT4G13650 Pentatricopeptide repeat (PPR)... Lus10018978 10.5 0.8791
AT3G55060 unknown protein Lus10030304 13.4 0.8733
AT5G37570 Pentatricopeptide repeat (PPR-... Lus10014212 15.1 0.8719
AT1G56570 PGN PENTATRICOPEPTIDE REPEAT PROTE... Lus10014027 15.6 0.8825
AT3G55510 RBL REBELOTE, Noc2p family (.1) Lus10026968 17.3 0.8558
AT1G16650 S-adenosyl-L-methionine-depend... Lus10013723 17.3 0.8673
AT5G11030 ALF4 aberrant lateral root formatio... Lus10006197 18.0 0.8497

Lus10038928 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.