Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G18400 253 / 4e-83 NAC ANAC058 NAC domain containing protein 58 (.1) AT2G24430 244 / 2e-79 NAC ANAC039, ANAC038 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) AT5G53950 238 / 3e-76 NAC ATCUC2, CUC2, ANAC098 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT5G07680 234 / 2e-75 NAC ANAC079, ATNAC4, ANAC080 Arabidopsis NAC domain containing protein 79, NAC domain containing protein 80 (.1.2) AT5G61430 234 / 3e-75 NAC ANAC100, ATNAC5 NAC domain containing protein 100 (.1) AT5G18270 228 / 6e-73 NAC ANAC087 Arabidopsis NAC domain containing protein 87 (.1.2) AT3G15170 226 / 2e-72 NAC ATNAC1, CUC1, ANAC054 CUP-SHAPED COTYLEDON1, Arabidopsis NAC domain containing protein 54, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT5G39610 223 / 1e-71 NAC ORE1, AtNAC2, ANAC092, ATNAC6 ORESARA 1, NAC domain containing protein 2, Arabidopsis NAC domain containing protein 92, NAC domain containing protein 6 (.1) AT3G04060 223 / 5e-71 NAC ANAC046 NAC domain containing protein 46 (.1) AT1G76420 219 / 2e-69 NAC NAC368, CUC3, ANAC031 CUP SHAPED COTYLEDON3, Arabidopsis NAC domain containing protein 31, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027227 [exp] 500 / 1e-180 AT3G18400 275 / 1e-91 NAC domain containing protein 58 (.1) Lus10009669 [exp] 297 / 7e-100 AT3G18400 308 / 3e-104 NAC domain containing protein 58 (.1) Lus10009029 [exp] 296 / 2e-99 AT3G18400 311 / 3e-105 NAC domain containing protein 58 (.1) Lus10020165 [exp] 248 / 5e-80 AT2G24430 306 / 2e-102 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Lus10026966 [exp] 244 / 6e-79 AT2G24430 311 / 6e-105 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Lus10001648 [exp] 238 / 6e-77 AT5G61430 359 / 4e-124 NAC domain containing protein 100 (.1) Lus10021659 [exp] 238 / 7e-77 AT5G61430 361 / 8e-125 NAC domain containing protein 100 (.1) Lus10005537 [exp] 237 / 8e-77 AT5G53950 317 / 3e-107 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10026879 [exp] 233 / 9e-75 AT5G18270 325 / 3e-110 Arabidopsis NAC domain containing protein 87 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G046800 [exp] 291 / 6e-98 AT3G18400 326 / 1e-111 NAC domain containing protein 58 (.1) Potri.012G056300 [exp] 290 / 7e-98 AT3G18400 317 / 6e-108 NAC domain containing protein 58 (.1) Potri.006G277000 [exp] 254 / 5e-83 AT2G24430 340 / 1e-116 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Potri.018G003800 [exp] 251 / 8e-82 AT2G24430 350 / 1e-120 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Potri.011G115400 [exp] 239 / 4e-77 AT5G53950 312 / 1e-104 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.012G001400 [exp] 236 / 7e-76 AT5G61430 448 / 1e-158 NAC domain containing protein 100 (.1) Potri.001G396300 [exp] 231 / 2e-74 AT5G53950 299 / 5e-100 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.015G020000 [exp] 231 / 4e-74 AT5G61430 446 / 1e-157 NAC domain containing protein 100 (.1) Potri.002G005800 [exp] 231 / 3e-73 AT1G76420 326 / 7e-110 CUP SHAPED COTYLEDON3, Arabidopsis NAC domain containing protein 31, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.019G031600 [exp] 230 / 3e-73 AT5G18270 328 / 6e-111 Arabidopsis NAC domain containing protein 87 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10038937 pacid=23150380 polypeptide=Lus10038937 locus=Lus10038937.g ID=Lus10038937.BGIv1.0 annot-version=v1.0 ATGGAGGAGATCAATCTACCTCCGGGGTTCAGATTCCATCCGACGGACGAAGAGCTCGTAAGTTTCTACCTGACTCACAGGATTTCGGACAAGAGCTTCA CCTGCAGGGCCATTGTCGACGTTGATCTCAACAAGAACGAGCCTTGGGATCTTCCAGGGAAAGCATCGATGGGGGAGAAGGAGTGGTACTTCTTCAACGT AAGGGACAGGAAGTACCCGACCGGTCTACGAACCAACCGAGCAACCGAAGCCGGGTATTGGAAGACCACTGGTAGGGACAAGGAGATCTTCTGTACAACG ACTGGTGTTCTTATTGGGATGAAGAAAACCCTGGTTTTCTACCAAGGTAGAGCTCCCAAAGGCCAGAAAAGCAATTGGGTCATCCATGAATTTCGCCTCC ATAACATCAACAACAACCATAGCTACAAATCCAACAAGGAAGAGTGGGTGGTGTGCAGGGTATTCCACAAGAACACAACACCAGCAAAGAAACCCCACCG AGACCAGTCCACGTCATCACCATCTTCATCCCAAGACGACGACACCACCACCATCAACAACATCGACTTTGCAAACATTGACAACACCGATCGCTACTTC AACTCACATCTAAACGGCGCCGTTTCAACCTACAACAACTACAACAATCTACATATGGACCAAGTTGGCTCTTCCACTTCGACGACGTCGTTTCCATGGC CCATTACTACGAGTACTGCTGATCATAACTTGATTGCAGCATCCAACCTTACCATGAACTATTCCTTTATCCTCAAGGCACTCCAGTTCAGGAATTACCA GGAGAGAGAGGCCGCGGCAGATTACTCCTCCATGTTGAGCCTTGATCATCATGAGACGCTGCCGCCGCTAGAGCAGCCGCCGGAGGAACCATTCAATATG GACTCCATTTGGTGA
AA sequence Show only first row Show all	>Lus10038937 pacid=23150380 polypeptide=Lus10038937 locus=Lus10038937.g ID=Lus10038937.BGIv1.0 annot-version=v1.0 MEEINLPPGFRFHPTDEELVSFYLTHRISDKSFTCRAIVDVDLNKNEPWDLPGKASMGEKEWYFFNVRDRKYPTGLRTNRATEAGYWKTTGRDKEIFCTT TGVLIGMKKTLVFYQGRAPKGQKSNWVIHEFRLHNINNNHSYKSNKEEWVVCRVFHKNTTPAKKPHRDQSTSSPSSSQDDDTTTINNIDFANIDNTDRYF NSHLNGAVSTYNNYNNLHMDQVGSSTSTTSFPWPITTSTADHNLIAASNLTMNYSFILKALQFRNYQEREAAADYSSMLSLDHHETLPPLEQPPEEPFNM DSIW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G18400	NAC	ANAC058	NAC domain containing protein ...		Lus10038937 [exp]	0	1
AT1G34670	MYB	ATMYB93	myb domain protein 93 (.1)		Lus10041142 [exp]	1.7	0.9753
AT5G10280	MYB	ATMYB92, AtMYB6...	myb domain protein 92 (.1)		Lus10036472 [exp]	2.4	0.9729
AT1G16060	AP2_ERF	ADAP	ARIA-interacting double AP2 do...		Lus10001553 [exp]	2.8	0.9519
AT3G24570			Peroxisomal membrane 22 kDa (M...		Lus10011679 [exp]	4.2	0.9582
AT3G18400	NAC	ANAC058	NAC domain containing protein ...		Lus10027227 [exp]	5.5	0.9476
AT2G40370		LAC5	laccase 5 (.1)		Lus10007531 [exp]	7.4	0.9504
AT1G20160		ATSBT5.2	Subtilisin-like serine endopep...		Lus10032096 [exp]	7.9	0.9397
AT3G11780			MD-2-related lipid recognition...		Lus10021256 [exp]	10.6	0.9381
AT3G24570			Peroxisomal membrane 22 kDa (M...		Lus10022130 [exp]	11.5	0.9291
AT2G48140		EDA4	embryo sac development arrest ...		Lus10014683 [exp]	12.7	0.9353

Compare expression of checked genes

Lus10038937 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.