Lus10038941 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G15220 212 / 2e-71 ATCCMH cytochrome c biogenesis protein family (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027231 332 / 6e-119 AT1G15220 212 / 2e-71 cytochrome c biogenesis protein family (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G052000 241 / 4e-83 AT1G15220 216 / 8e-73 cytochrome c biogenesis protein family (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03918 CcmH Cytochrome C biogenesis protein
Representative CDS sequence
>Lus10038941 pacid=23150433 polypeptide=Lus10038941 locus=Lus10038941.g ID=Lus10038941.BGIv1.0 annot-version=v1.0
ATGGAGAACAAAAGCGATGATGAAGTTAAGAACTCGCGAATTATGGAGGCTCGTGCCAGAAACATTAGTCATAACGTCAGGTGCACCGAGTGCGGGAGTC
AGTCCATTGAAGATTCTCAAGCTGACATTGCCGTTCTCCTCAGGAAGTTGATCCGTGAGGAGGTCCAGGCTGGAAAATCCGACAAAGAGATCTTCAAGAA
GCTAGAGGATGAATTTGGAGAGACGGTTCTCTACGCACCGAAGTTCGATTGGCAGACTGCTGGGATATGGCTATCACCACTTTTGATTGTAGGTACTGCT
GGAGGGATATGGGCTTACGGAAAGCACAGGCAGAATACTAATGTGCATATCATGGCACTAAATCTCGTGAGGGGCGTTACGCTAACACCAAAAGAGAAGG
AGACGATGCTGGAGATTCTAACGCCTCCTCCCCCACAAAGAGCCCCTCTTCTTCTGTCCTGGTGGAGGAAAATGATAACGTGA
AA sequence
>Lus10038941 pacid=23150433 polypeptide=Lus10038941 locus=Lus10038941.g ID=Lus10038941.BGIv1.0 annot-version=v1.0
MENKSDDEVKNSRIMEARARNISHNVRCTECGSQSIEDSQADIAVLLRKLIREEVQAGKSDKEIFKKLEDEFGETVLYAPKFDWQTAGIWLSPLLIVGTA
GGIWAYGKHRQNTNVHIMALNLVRGVTLTPKEKETMLEILTPPPPQRAPLLLSWWRKMIT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G15220 ATCCMH cytochrome c biogenesis protei... Lus10038941 0 1
AT1G09630 ATRAB-A2A, ATRA... ARABIDOPSIS RAB GTPASE A2A, RA... Lus10036441 6.3 0.6511
AT1G26100 Cytochrome b561/ferric reducta... Lus10021715 11.5 0.6743
Lus10025143 13.8 0.6746
AT5G42700 B3 AP2/B3-like transcriptional fa... Lus10032748 21.1 0.6727
AT1G19240 unknown protein Lus10034891 26.7 0.6662
AT3G52040 unknown protein Lus10005332 28.9 0.6282
AT3G42150 unknown protein Lus10011614 33.0 0.6172
AT3G12550 FDM3 factor of DNA methylation 3, X... Lus10000950 50.3 0.5981
AT5G23050 AAE17 acyl-activating enzyme 17 (.1) Lus10027257 84.0 0.5898
AT2G21240 BBR_BPC BPC4, BBR/BPC4,... basic pentacysteine 4 (.1.2) Lus10035462 88.7 0.5569

Lus10038941 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.