Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G18295 52 / 6e-10 Protein of unknown function (DUF1639) (.1) AT1G25370 52 / 1e-09 Protein of unknown function (DUF1639) (.1) AT1G48770 44 / 5e-07 Protein of unknown function (DUF1639) (.1) AT3G60410 44 / 8e-07 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2), Protein of unknown function (DUF1639) (.3) AT4G17440 43 / 2e-06 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2) AT1G68340 42 / 3e-06 Protein of unknown function (DUF1639) (.1) AT4G20300 37 / 0.0002 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027232 [exp] 102 / 4e-30 AT1G68340 75 / 3e-17 Protein of unknown function (DUF1639) (.1) Lus10035144 [exp] 49 / 1e-08 AT1G25370 87 / 2e-20 Protein of unknown function (DUF1639) (.1) Lus10004378 [exp] 46 / 2e-07 AT4G17440 96 / 4e-23 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2) Lus10010984 [exp] 44 / 7e-07 AT3G60410 89 / 3e-20 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2), Protein of unknown function (DUF1639) (.3) Lus10040176 [exp] 37 / 0.0003 AT3G60410 76 / 1e-16 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2), Protein of unknown function (DUF1639) (.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G122700 [exp] 70 / 4e-16 AT1G25370 110 / 1e-28 Protein of unknown function (DUF1639) (.1) Potri.008G122600 [exp] 69 / 9e-16 AT1G25370 100 / 6e-25 Protein of unknown function (DUF1639) (.1) Potri.012G055200 [exp] 62 / 2e-13 AT3G18295 109 / 3e-29 Protein of unknown function (DUF1639) (.1) Potri.002G136200 [exp] 55 / 9e-11 AT3G60410 109 / 6e-28 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2), Protein of unknown function (DUF1639) (.3) Potri.014G044800 [exp] 52 / 9e-10 AT3G60410 105 / 6e-26 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2), Protein of unknown function (DUF1639) (.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07797 [flax] [poplar] DUF1639 Protein of unknown function (DUF1639)
Representative CDS sequence Show only first row Show all	>Lus10038942 pacid=23150660 polypeptide=Lus10038942 locus=Lus10038942.g ID=Lus10038942.BGIv1.0 annot-version=v1.0 ATGAAGCTGTGTGTTCCGCTGACCAGGGATGAGATTGAAGAAGATTTTATGGAGATTGCTAGGATGAGACCCCCCAGGAGACCCAAGAAGAGGCCCAGAA TTGTTCAGAAGTATATGGATTTAATGTTCCCAGGGCTATGGATAACTGAAGTCACAACAGATCTATACAAAGTTCCCGAAGTACCGGAATCATGA
AA sequence Show only first row Show all	>Lus10038942 pacid=23150660 polypeptide=Lus10038942 locus=Lus10038942.g ID=Lus10038942.BGIv1.0 annot-version=v1.0 MKLCVPLTRDEIEEDFMEIARMRPPRRPKKRPRIVQKYMDLMFPGLWITEVTTDLYKVPEVPES

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G25370			Protein of unknown function (D...		Lus10038942 [exp]	0	1
AT5G40650		SDH2-2	succinate dehydrogenase 2-2 (....		Lus10022319 [exp]	7.5	0.9327
AT4G25030			unknown protein		Lus10036513 [exp]	9.7	0.9259
AT4G36990	HSF	AT-HSFB1, ATHSF...	ARABIDOPSIS THALIANA HEAT SHOC...		Lus10019348 [exp]	13.5	0.9403
AT1G74360			Leucine-rich repeat protein ki...		Lus10003477 [exp]	14.1	0.9397
AT1G49820		MTK1, ATMTK	5-methylthioribose kinase 1, S...		Lus10027858 [exp]	15.0	0.9271
AT4G03320		AtTic20-IV, TIC...	translocon at the inner envelo...		Lus10039783 [exp]	16.9	0.9146
AT4G30600			signal recognition particle re...		Lus10017891 [exp]	17.7	0.9360
AT3G17800			Protein of unknown function (D...		Lus10041984 [exp]	21.6	0.9391
AT3G48890		MSBP2, ATMP2, A...	MEMBRANE STEROID BINDING PROTE...		Lus10005746 [exp]	23.0	0.9095
AT5G58730			pfkB-like carbohydrate kinase ...		Lus10018235 [exp]	25.2	0.9092

Compare expression of checked genes

Lus10038942 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.