Lus10038954 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G18170 163 / 6e-50 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT1G73655 152 / 5e-46 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT4G26555 49 / 3e-07 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT4G19830 49 / 6e-07 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT5G13410 45 / 2e-05 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT3G10060 40 / 0.0006 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027246 316 / 1e-110 AT1G18170 187 / 2e-59 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10031342 129 / 4e-37 AT1G18170 261 / 3e-89 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10038345 55 / 5e-09 AT4G19830 262 / 3e-89 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10036206 50 / 1e-07 AT4G19830 260 / 4e-89 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10042897 45 / 1e-05 AT3G60370 312 / 8e-109 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10009828 45 / 2e-05 AT5G13410 314 / 1e-108 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10040937 44 / 4e-05 AT5G13410 317 / 1e-109 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10028194 43 / 9e-05 AT3G60370 305 / 2e-104 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10032895 41 / 0.0006 AT4G26550 338 / 8e-116 Got1/Sft2-like vescicle transport protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G048300 161 / 4e-49 AT1G18170 249 / 3e-83 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.012G119800 52 / 4e-08 AT4G19830 270 / 5e-92 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.001G068300 45 / 1e-05 AT5G13410 332 / 4e-116 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.014G045600 45 / 1e-05 AT3G60370 302 / 3e-104 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0487 FKBP PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Representative CDS sequence
>Lus10038954 pacid=23150299 polypeptide=Lus10038954 locus=Lus10038954.g ID=Lus10038954.BGIv1.0 annot-version=v1.0
ATGACGATGATGAAGATAACTCCATCCATGATAACAGGAGGAAGACAGCAGCCATTACTAAGCCAACCCTTCACTGCAACAAGAACAAGTTCAAGAAGCA
GGAGCTTCAGCAGCATCAGTTGCTTACTTCAAACACAGAAGCTAATGATGACAGATTCGTCCGCTGGCTTGACACGGAGATCAGGACTTGGAGCAGCAGG
GATCTCTTGGGCAGCTTTTCTAGCTTCCCGCATCGTGTCCCGGAAGAAGACCAAAGACACCAGAGACATGGAGAAGGAAGGAGTAGTGGTTTTGCCAAAT
GGAATAAGGTACTATGATATGGAGGTAGGAACAGGGGAATGTCCAAGGGCAGGAGACTTGGTGGTGATGAATCTAAAGGGGAATGTAGTTGGAGGGAAAG
ACGGGGAAGTGATTGTCGACACATTCGAAGGAATGAAGAAGAAGAAGCCGATGGCTATGGTGGTAATGGGTTCAAGGCCATACAGTAAAGGGATGTGTGA
AGGGATAGAGCATGTGGTGAGATCAATGAAGGCTGGTGGTGTAAGAAGGGTTATTGTACCTCCTAGCTTCGGATTCGGTGTCCATGGTGCCGATTTCGGG
TCTTCTTCTTCTCAAAACATCCCACCTTCTTCCACTCTCGAGTACATTGTTGAGGTTCACAGTGTCTCCACCTGA
AA sequence
>Lus10038954 pacid=23150299 polypeptide=Lus10038954 locus=Lus10038954.g ID=Lus10038954.BGIv1.0 annot-version=v1.0
MTMMKITPSMITGGRQQPLLSQPFTATRTSSRSRSFSSISCLLQTQKLMMTDSSAGLTRRSGLGAAGISWAAFLASRIVSRKKTKDTRDMEKEGVVVLPN
GIRYYDMEVGTGECPRAGDLVVMNLKGNVVGGKDGEVIVDTFEGMKKKKPMAMVVMGSRPYSKGMCEGIEHVVRSMKAGGVRRVIVPPSFGFGVHGADFG
SSSSQNIPPSSTLEYIVEVHSVST

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G18170 FKBP-like peptidyl-prolyl cis-... Lus10038954 0 1
AT1G30380 PSAK photosystem I subunit K (.1) Lus10012086 2.2 0.9868
AT1G30380 PSAK photosystem I subunit K (.1) Lus10007399 3.5 0.9834
AT4G05180 PSII-Q, PSBQ, P... photosystem II subunit Q-2 (.1... Lus10018385 4.5 0.9790
AT1G52230 PSAH2, PSAH-2, ... PHOTOSYSTEM I SUBUNIT H-2, pho... Lus10025798 4.6 0.9828
AT2G24020 Uncharacterised BCR, YbaB fami... Lus10015490 5.8 0.9605
AT2G20260 PSAE-2 photosystem I subunit E-2 (.1) Lus10011913 6.7 0.9789
AT1G22630 unknown protein Lus10018614 6.9 0.9613
AT4G12800 PSAL photosystem I subunit l (.1) Lus10002143 7.0 0.9753
AT1G67700 unknown protein Lus10006442 7.1 0.9661
AT5G64040 PSAN, PSI-N photosystem I reaction center ... Lus10002084 7.3 0.9769

Lus10038954 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.