Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G04170 45 / 4e-07 EIF2 GAMMA, EIF2GAMMA eukaryotic translation initiation factor 2 gamma subunit (.1) AT2G18720 39 / 4e-05 Translation elongation factor EF1A/initiation factor IF2gamma family protein (.1) AT4G18330 39 / 8e-05 Translation elongation factor EF1A/initiation factor IF2gamma family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024802 [exp] 42 / 8e-06 AT1G04170 853 / 0.0 eukaryotic translation initiation factor 2 gamma subunit (.1) Lus10005680 [exp] 42 / 8e-06 AT1G04170 846 / 0.0 eukaryotic translation initiation factor 2 gamma subunit (.1) Lus10018734 [exp] 42 / 8e-06 AT1G04170 852 / 0.0 eukaryotic translation initiation factor 2 gamma subunit (.1) Lus10020312 [exp] 42 / 8e-06 AT1G04170 845 / 0.0 eukaryotic translation initiation factor 2 gamma subunit (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G129100 [exp] 44 / 6e-07 AT1G04170 866 / 0.0 eukaryotic translation initiation factor 2 gamma subunit (.1) Potri.003G104900 [exp] 43 / 2e-06 AT1G04170 848 / 0.0 eukaryotic translation initiation factor 2 gamma subunit (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10038978 pacid=23150250 polypeptide=Lus10038978 locus=Lus10038978.g ID=Lus10038978.BGIv1.0 annot-version=v1.0 ATGCCCTCGCCCTATGGCGCCCTACAAGTGAGTCGATTCTCTGGATTCGAGCCTTGGCTCGATCTTTCGGACGTGAACAAGCCTGGCATTGAGACTGATG AGATGGAAGGTGGAGTCGCTGGAGGAAGTATCCTCAGGGTGTTGGTAGGGGAATGTGGTGTGTTTAATGAATTGAGCACTGTAACATGGTGA
AA sequence Show only first row Show all	>Lus10038978 pacid=23150250 polypeptide=Lus10038978 locus=Lus10038978.g ID=Lus10038978.BGIv1.0 annot-version=v1.0 MPSPYGALQVSRFSGFEPWLDLSDVNKPGIETDEMEGGVAGGSILRVLVGECGVFNELSTVTW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10038978 [exp]	0	1
AT5G51070		SAG15, CLPD, ER...	SENESCENCE ASSOCIATED GENE 15,...		Lus10012953 [exp]	1.4	0.9501
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10029377 [exp]	1.7	0.9744
AT4G00910			Aluminium activated malate tra...		Lus10001528 [exp]	3.9	0.9280
AT4G30380		EXLB2	Barwin-related endoglucanase (...		Lus10013118 [exp]	4.6	0.9104
AT1G11410			S-locus lectin protein kinase ...		Lus10007608 [exp]	5.5	0.9049
AT1G47710			Serine protease inhibitor (SER...		Lus10019009 [exp]	6.7	0.9262
AT2G15480		UGT73B5	UDP-glucosyl transferase 73B5 ...		Lus10026926 [exp]	6.9	0.9275
AT5G43190			Galactose oxidase/kelch repeat...		Lus10007740 [exp]	9.7	0.8767
AT5G38435		SPH8	S-protein homologue 8 (.1)		Lus10029385 [exp]	10.2	0.8935
AT1G65450			HXXXD-type acyl-transferase fa...		Lus10029920 [exp]	11.7	0.9095

Compare expression of checked genes

Lus10038978 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.