Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22240 50 / 1e-09 unknown protein AT1G05340 46 / 4e-08 unknown protein AT2G32190 45 / 6e-08 unknown protein AT2G32210 45 / 6e-08 unknown protein AT2G32200 42 / 2e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003815 [exp] 65 / 1e-15 AT2G32210 79 / 3e-21 unknown protein Lus10010460 [exp] 63 / 9e-15 AT2G32190 79 / 3e-21 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G019201 [exp] 48 / 4e-09 AT1G05340 / unknown protein Potri.006G021600 [exp] 46 / 2e-08 AT1G05340 / unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039015 pacid=23150636 polypeptide=Lus10039015 locus=Lus10039015.g ID=Lus10039015.BGIv1.0 annot-version=v1.0 ATGTCAATAAATCTATCTTTGGAAGAAAGCGGAGCATCAGCAGCAACATACCCGCAGCTGCCGCAATCGTACGCAGTCGGAGCGCCTCCGCCGATCGGAT ACCCGACCCGAGACAATTCGGAGCCTGCTGTTCCCGTTGAGACCAAGTCCAGAGGCGATGGGTTCTGGAAAGGCTGTTGCGCTGCATTGTGCTGCTGCTG TGTGCTGGACGCCTGTTTCTGA
AA sequence Show only first row Show all	>Lus10039015 pacid=23150636 polypeptide=Lus10039015 locus=Lus10039015.g ID=Lus10039015.BGIv1.0 annot-version=v1.0 MSINLSLEESGASAATYPQLPQSYAVGAPPPIGYPTRDNSEPAVPVETKSRGDGFWKGCCAALCCCCVLDACF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G32190			unknown protein		Lus10039015 [exp]	0	1
AT3G07170			Sterile alpha motif (SAM) doma...		Lus10011841 [exp]	1.0	0.9452
AT4G27290			S-locus lectin protein kinase ...		Lus10014810 [exp]	6.7	0.9383
AT5G54840		ATSGP1	Ras-related small GTP-binding ...		Lus10019615 [exp]	6.9	0.9349
AT4G21920			unknown protein		Lus10001143 [exp]	7.3	0.9404
AT5G04760	MYB		Duplicated homeodomain-like su...		Lus10036413 [exp]	7.5	0.9384
AT2G02800		Kin2, APK2B	protein kinase 2B (.1.2)		Lus10021489 [exp]	7.5	0.9446
AT1G01720	NAC	ATAF1, ANAC002	Arabidopsis NAC domain contain...		Lus10025690 [exp]	9.6	0.9258
AT5G04760	MYB		Duplicated homeodomain-like su...		Lus10041088 [exp]	10.1	0.9375
AT3G62420	bZIP	ATBZIP53	basic region/leucine zipper mo...		Lus10025024 [exp]	10.1	0.9280
AT2G32210			unknown protein		Lus10003815 [exp]	11.8	0.9295

Compare expression of checked genes

Lus10039015 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.