Lus10039017 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G15000 210 / 2e-71 Ribosomal L27e protein family (.1.2)
AT3G22230 209 / 7e-71 Ribosomal L27e protein family (.1)
AT2G32220 201 / 1e-67 Ribosomal L27e protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027314 237 / 4e-82 AT4G15000 233 / 2e-80 Ribosomal L27e protein family (.1.2)
Lus10010461 224 / 7e-77 AT4G15000 236 / 7e-82 Ribosomal L27e protein family (.1.2)
Lus10003814 223 / 2e-76 AT4G15000 239 / 7e-83 Ribosomal L27e protein family (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G019000 216 / 5e-74 AT4G15000 209 / 5e-71 Ribosomal L27e protein family (.1.2)
Potri.006G021500 213 / 8e-73 AT4G15000 205 / 2e-69 Ribosomal L27e protein family (.1.2)
Potri.001G342500 208 / 9e-71 AT4G15000 210 / 2e-71 Ribosomal L27e protein family (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01777 Ribosomal_L27e Ribosomal L27e protein family
CL0107 KOW PF00467 KOW KOW motif
Representative CDS sequence
>Lus10039017 pacid=23150417 polypeptide=Lus10039017 locus=Lus10039017.g ID=Lus10039017.BGIv1.0 annot-version=v1.0
ATGGTGAAGTTCATGAAGCCCCACAAGGCGGTGATCGTCCTCCAAGGCCGGTACGCCGGGAAGAAGGCGGTGATCGTGAAGAACTTCGACGACGGAGTTC
GCGACCGCGCCTACGGCCACTGTTTGGTTGCAGGGATCAAGAAGTACCCGGGCAAGGTTATCAGGAAGGATTCGGCCAAGAAGACCGCCAAGAAGTCCAG
AGTCAAGTGCTTCGTGAAGCTCGTGAACTACAGGCATCTGATGCCGACTAGGTACACCCTGGATGTGGACTTGAAGGACGCCGTATCCATCGAATCCCTG
GCGAGCAAGGAGAAGAAGGTCGCCGCCTGCAAGGACGCCAAGGCCAAGTTCGAGGAGAGGTTCAAGACCGGCAAGAACAGGTGGTTCTTTACCAAACTCA
GGTTTTAG
AA sequence
>Lus10039017 pacid=23150417 polypeptide=Lus10039017 locus=Lus10039017.g ID=Lus10039017.BGIv1.0 annot-version=v1.0
MVKFMKPHKAVIVLQGRYAGKKAVIVKNFDDGVRDRAYGHCLVAGIKKYPGKVIRKDSAKKTAKKSRVKCFVKLVNYRHLMPTRYTLDVDLKDAVSIESL
ASKEKKVAACKDAKAKFEERFKTGKNRWFFTKLRF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G15000 Ribosomal L27e protein family ... Lus10039017 0 1
AT2G03530 ATUPS2, UPS2 ARABIDOPSIS THALIANA UREIDE PE... Lus10036911 1.0 0.9481
AT3G16080 Zinc-binding ribosomal protein... Lus10011446 2.0 0.9257
AT1G09590 Translation protein SH3-like f... Lus10021079 2.0 0.9076
AT3G53430 Ribosomal protein L11 family p... Lus10015086 2.4 0.8907
AT1G26740 Ribosomal L32p protein family ... Lus10008442 2.4 0.9135
AT4G15000 Ribosomal L27e protein family ... Lus10027314 3.2 0.9062
AT1G73940 unknown protein Lus10017355 5.7 0.8512
AT5G04800 Ribosomal S17 family protein (... Lus10021307 6.7 0.8501
AT5G66140 PAD2 proteasome alpha subunit D2 (.... Lus10041890 7.1 0.8190
AT3G13882 Ribosomal protein L34 (.1.2) Lus10037626 8.1 0.8496

Lus10039017 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.