Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G18020 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) AT5G18080 117 / 5e-36 SAUR24 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) AT5G18030 117 / 5e-36 SAUR-like auxin-responsive protein family (.1) AT5G18050 116 / 2e-35 SAUR-like auxin-responsive protein family (.1) AT5G18060 115 / 4e-35 SAUR-like auxin-responsive protein family (.1) AT5G18010 113 / 2e-34 SAUR19, SAUR24 small auxin up RNA 19, SAUR-like auxin-responsive protein family (.1) AT4G38840 113 / 3e-34 SAUR-like auxin-responsive protein family (.1) AT3G03840 111 / 2e-33 SAUR-like auxin-responsive protein family (.1) AT2G21200 110 / 4e-33 SAUR-like auxin-responsive protein family (.1) AT4G34770 110 / 8e-33 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027317 [exp] 196 / 9e-67 AT5G18030 119 / 1e-36 SAUR-like auxin-responsive protein family (.1) Lus10009001 [exp] 160 / 6e-53 AT4G38840 122 / 9e-38 SAUR-like auxin-responsive protein family (.1) Lus10032173 [exp] 161 / 7e-53 AT4G38840 119 / 3e-36 SAUR-like auxin-responsive protein family (.1) Lus10025909 [exp] 154 / 3e-50 AT4G34770 116 / 3e-35 SAUR-like auxin-responsive protein family (.1) Lus10029198 [exp] 154 / 4e-50 AT4G38840 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10008991 [exp] 152 / 2e-49 AT4G38840 115 / 4e-35 SAUR-like auxin-responsive protein family (.1) Lus10008992 [exp] 150 / 7e-49 AT2G21200 116 / 2e-35 SAUR-like auxin-responsive protein family (.1) Lus10009628 [exp] 150 / 8e-49 AT4G38840 123 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10009623 [exp] 150 / 8e-49 AT4G38840 123 / 3e-38 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G126700 [exp] 150 / 5e-49 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1) Potri.009G126500 [exp] 149 / 3e-48 AT5G18020 124 / 1e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G164600 [exp] 141 / 3e-45 AT4G38840 115 / 5e-35 SAUR-like auxin-responsive protein family (.1) Potri.009G126300 [exp] 140 / 4e-45 AT5G18060 123 / 2e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G165200 [exp] 139 / 2e-44 AT5G18020 122 / 6e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G164800 [exp] 137 / 2e-43 AT4G38840 120 / 3e-37 SAUR-like auxin-responsive protein family (.1) Potri.009G126400 [exp] 125 / 5e-39 AT5G18020 119 / 1e-36 SAUR-like auxin-responsive protein family (.1) Potri.004G164700 [exp] 120 / 4e-37 AT5G18020 122 / 8e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G165500 [exp] 119 / 1e-36 AT4G34770 115 / 7e-35 SAUR-like auxin-responsive protein family (.1) Potri.009G127100 [exp] 117 / 6e-36 AT5G18080 103 / 2e-30 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10039020 pacid=23150427 polypeptide=Lus10039020 locus=Lus10039020.g ID=Lus10039020.BGIv1.0 annot-version=v1.0 ATGGCTATTGGTTTGCCTGGCAGTCTTGCTAAACAGATCCTCCCTCGATCTTGGTCCGGCGCCAACAAAACAGCGTCAAGGTTCCCAGATGTGCCGAAAG GTTTCTTGGCGGTGTATGTCGGAGAGACGCAAAAGAAGAGATTTGTGGTGCCGGTGTCTTATTTGAGCCAGCTTTTGTTTCAGGAGTTGTTAAGCATGGC AGAAGAAGAGTTTGGGTTTGATCATCCCATGGGTGGCTTGACACTCCCCTGCAGTGAAGACACTTTCATTTCTGTTACTTCAGCTTTGAGCAGATCTTAA
AA sequence Show only first row Show all	>Lus10039020 pacid=23150427 polypeptide=Lus10039020 locus=Lus10039020.g ID=Lus10039020.BGIv1.0 annot-version=v1.0 MAIGLPGSLAKQILPRSWSGANKTASRFPDVPKGFLAVYVGETQKKRFVVPVSYLSQLLFQELLSMAEEEFGFDHPMGGLTLPCSEDTFISVTSALSRS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G18020			SAUR-like auxin-responsive pro...		Lus10039020 [exp]	0	1
AT2G18300	bHLH	bHLH064, HBI1	basic helix-loop-helix (bHLH) ...		Lus10014300 [exp]	1.4	0.9264
					Lus10038294 [exp]	1.7	0.9169
AT1G04240	AUX_IAA	IAA3, SHY2	SHORT HYPOCOTYL 2, indole-3-ac...		Lus10024853 [exp]	5.0	0.8952
AT2G40610		ATHEXPALPHA1.11...	expansin A8 (.1)		Lus10029038 [exp]	5.7	0.8561
AT5G23160			unknown protein		Lus10013437 [exp]	5.8	0.9174
AT4G14550	AUX_IAA	SLR, IAA14	SOLITARY ROOT, indole-3-acetic...		Lus10039487 [exp]	7.5	0.8957
AT2G40610		ATHEXPALPHA1.11...	expansin A8 (.1)		Lus10034227 [exp]	8.4	0.8587
					Lus10040168 [exp]	9.2	0.8211
AT4G38840			SAUR-like auxin-responsive pro...		Lus10038193 [exp]	9.9	0.8319
AT4G38840			SAUR-like auxin-responsive pro...		Lus10025910 [exp]	14.2	0.8096

Compare expression of checked genes

Lus10039020 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.