Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039025 pacid=23150565 polypeptide=Lus10039025 locus=Lus10039025.g ID=Lus10039025.BGIv1.0 annot-version=v1.0 ATGATAAGTAAGTTGCAGCTCAAGCATCTTGCTTTGCCCCGCAAGCATCTTCCTGCTCAGAAACACACTTCCATCACTTTCTTCCAAGGAAACAATACAG ATATCTCCCAAGAATCCTTGTATAATTTAGGCAAGGATGGTTTTCCCACGGCTCAGGCTTTCCAACTAGGGAGGAGGGTTCCATCCCTTTGTGGTGGGAC ATCATCGATTCCAACGCAGTTTTTCGTACTTCTTGGCGAATTGCTTGCTGCACTTCAGTATCAACGATTAGGAAACAAGTATGAATGTGAATTGTGA
AA sequence Show only first row Show all	>Lus10039025 pacid=23150565 polypeptide=Lus10039025 locus=Lus10039025.g ID=Lus10039025.BGIv1.0 annot-version=v1.0 MISKLQLKHLALPRKHLPAQKHTSITFFQGNNTDISQESLYNLGKDGFPTAQAFQLGRRVPSLCGGTSSIPTQFFVLLGELLAALQYQRLGNKYECEL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10039025 [exp]	0	1
AT3G60330		AHA7	H\(+\)-ATPase 7, H\(+\)-ATPase...		Lus10042904 [exp]	1.0	0.9556
AT2G39530			Uncharacterised protein family...		Lus10031303 [exp]	2.0	0.9446
AT3G23770			O-Glycosyl hydrolases family 1...		Lus10023226 [exp]	3.5	0.9409
AT3G13040	GARP		myb-like HTH transcriptional r...		Lus10028102 [exp]	3.5	0.9308
AT4G05220			Late embryogenesis abundant (L...		Lus10020066 [exp]	4.9	0.8948
AT1G10800			unknown protein		Lus10037441 [exp]	5.5	0.9363
AT4G12310		CYP706A5	"cytochrome P450, family 706, ...		Lus10024580 [exp]	5.7	0.9249
					Lus10032858 [exp]	6.0	0.8898
AT2G31730	bHLH		basic helix-loop-helix (bHLH) ...		Lus10041649 [exp]	6.0	0.9403
AT1G07250		UGT71C4	UDP-glucosyl transferase 71C4 ...		Lus10027335 [exp]	8.1	0.8955

Compare expression of checked genes

Lus10039025 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.