Lus10039026 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G12570 96 / 2e-23 UPL5 ubiquitin protein ligase 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027324 138 / 1e-39 AT4G12570 373 / 1e-121 ubiquitin protein ligase 5 (.1)
Lus10010493 130 / 1e-35 AT4G12570 830 / 0.0 ubiquitin protein ligase 5 (.1)
Lus10003792 90 / 5e-22 AT4G12570 409 / 3e-136 ubiquitin protein ligase 5 (.1)
Lus10002605 51 / 7e-08 AT1G55860 1128 / 0.0 ubiquitin-protein ligase 1 (.1.2)
Lus10032830 51 / 8e-08 AT1G55860 1189 / 0.0 ubiquitin-protein ligase 1 (.1.2)
Lus10008636 41 / 0.0002 AT3G53090 1270 / 0.0 ubiquitin-protein ligase 7 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G011701 134 / 4e-37 AT4G12570 842 / 0.0 ubiquitin protein ligase 5 (.1)
Potri.016G012900 132 / 2e-36 AT4G12570 853 / 0.0 ubiquitin protein ligase 5 (.1)
Potri.016G059800 82 / 9e-19 AT4G12570 733 / 0.0 ubiquitin protein ligase 5 (.1)
Potri.002G110500 45 / 9e-06 AT1G55860 1125 / 0.0 ubiquitin-protein ligase 1 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0552 Hect PF00632 HECT HECT-domain (ubiquitin-transferase)
Representative CDS sequence
>Lus10039026 pacid=23150594 polypeptide=Lus10039026 locus=Lus10039026.g ID=Lus10039026.BGIv1.0 annot-version=v1.0
ATGGATGCTGAGTATATTGATTCTGATGCTTTAGCGCTGACGTTTGTTAGGGACGTTGAGCAGTACTTGCGACCCAGGAAGTTTATAGAACTCTTCCCAG
GCGGGGAAAACATCGCAGTGAATAGCAAGAACAGAAAAGTTTATATAAACCTTGTGATTCGACATCGATTCGTCACGTCTATCTCTGAACAGATAGTGGA
GAAAATGACAGCAGAGCAAAGGAAGACGCTGCTCTTCTTCTGGACATTGGTGAAATATCTGCTGTACGAGGGTTTCAGAGGTTTAGGTAGTGAGCTGTGG
ATATGCGGGACTCAGGAACGACATGATCGGTTGCCTTCATCTCACACATGCTTCTACGAGCTGCTTGTTCCGGCTTATCCATCTATGGACGATCGATTCC
GCCTGATAACCCAAGACTACATCGGATTGAGCTATGGCAGTCCCTGA
AA sequence
>Lus10039026 pacid=23150594 polypeptide=Lus10039026 locus=Lus10039026.g ID=Lus10039026.BGIv1.0 annot-version=v1.0
MDAEYIDSDALALTFVRDVEQYLRPRKFIELFPGGENIAVNSKNRKVYINLVIRHRFVTSISEQIVEKMTAEQRKTLLFFWTLVKYLLYEGFRGLGSELW
ICGTQERHDRLPSSHTCFYELLVPAYPSMDDRFRLITQDYIGLSYGSP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G12570 UPL5 ubiquitin protein ligase 5 (.1... Lus10039026 0 1
Lus10021782 2.4 1.0000
Lus10023587 3.7 1.0000
AT1G74670 GASA6 GA-stimulated Arabidopsis 6, G... Lus10024216 4.6 1.0000
AT2G25470 AtRLP21 receptor like protein 21 (.1) Lus10027855 5.7 1.0000
AT3G19540 Protein of unknown function (D... Lus10028040 5.9 1.0000
AT3G20800 Cell differentiation, Rcd1-lik... Lus10031542 6.9 1.0000
Lus10007927 7.0 1.0000
AT5G45650 subtilase family protein (.1) Lus10026062 8.1 0.9977
AT1G48120 hydrolases;protein serine/thre... Lus10015869 8.5 1.0000
AT2G34320 Polynucleotidyl transferase, r... Lus10039942 8.5 1.0000

Lus10039026 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.