Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G47520 259 / 2e-89 AtRABA5a RAB GTPase homolog A5A (.1) AT2G31680 210 / 3e-70 AtRABA5d RAB GTPase homolog A5D (.1) AT2G43130 209 / 6e-70 ARA4, AtRab11F, AtRABA5c, Ara-4 ARABIDOPSIS RAB GTPASE HOMOLOG A5C, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G05810 209 / 3e-69 ARA, Ara-1, AtRab11D, AtRABA5e ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) AT3G07410 204 / 1e-67 AtRABA5b RAB GTPase homolog A5B (.1) AT4G39990 195 / 5e-64 ATGB3, AtRABA4b, AtRab11G ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A 4B, GTP-BINDING PROTEIN 3, RAB GTPase homolog A4B (.1) AT1G16920 193 / 2e-63 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1) AT5G65270 193 / 3e-63 AtRABA4a RAB GTPase homolog A4A (.1) AT4G18800 189 / 7e-62 AthSGBP, AtRab11B, AtRABA1d RAB GTPase homolog A1D (.1) AT1G07410 188 / 1e-61 ATRAB-A2B, AtRABA2b ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038807 [exp] 273 / 4e-95 AT5G47520 376 / 2e-134 RAB GTPase homolog A5A (.1) Lus10000536 [exp] 258 / 7e-89 AT5G47520 369 / 3e-131 RAB GTPase homolog A5A (.1) Lus10017558 [exp] 255 / 1e-87 AT5G47520 367 / 1e-130 RAB GTPase homolog A5A (.1) Lus10026731 [exp] 208 / 3e-69 AT2G31680 381 / 2e-136 RAB GTPase homolog A5D (.1) Lus10025516 [exp] 208 / 3e-69 AT2G31680 381 / 2e-136 RAB GTPase homolog A5D (.1) Lus10038226 [exp] 196 / 1e-64 AT1G05810 333 / 3e-117 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) Lus10025876 [exp] 196 / 1e-64 AT1G05810 331 / 1e-116 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) Lus10000637 [exp] 195 / 6e-64 AT5G65270 395 / 8e-142 RAB GTPase homolog A4A (.1) Lus10023153 [exp] 194 / 7e-64 AT5G65270 396 / 3e-142 RAB GTPase homolog A4A (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G010300 [exp] 260 / 1e-89 AT5G47520 395 / 7e-142 RAB GTPase homolog A5A (.1) Potri.006G015400 [exp] 258 / 5e-89 AT5G47520 398 / 5e-143 RAB GTPase homolog A5A (.1) Potri.014G150300 [exp] 209 / 6e-70 AT2G31680 374 / 1e-133 RAB GTPase homolog A5D (.1) Potri.002G231800 [exp] 209 / 7e-70 AT2G31680 374 / 1e-133 RAB GTPase homolog A5D (.1) Potri.002G249500 [exp] 200 / 3e-66 AT1G05810 333 / 8e-117 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) Potri.005G073000 [exp] 192 / 4e-63 AT5G65270 402 / 1e-144 RAB GTPase homolog A4A (.1) Potri.007G096000 [exp] 192 / 7e-63 AT5G65270 404 / 2e-145 RAB GTPase homolog A4A (.1) Potri.011G070300 [exp] 191 / 1e-62 AT5G45750 392 / 1e-140 RAB GTPase homolog A1C (.1) Potri.016G000400 [exp] 189 / 4e-62 AT1G07410 380 / 4e-136 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.004G061000 [exp] 189 / 9e-62 AT4G18800 392 / 9e-141 RAB GTPase homolog A1D (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00071 [flax] [poplar] Ras Ras family
Representative CDS sequence Show only first row Show all	>Lus10039051 pacid=23150692 polypeptide=Lus10039051 locus=Lus10039051.g ID=Lus10039051.BGIv1.0 annot-version=v1.0 ATGGCATTTTACGCTCAAGAGGACAAGGCGGATGATTACCTGTTCAAGATAGTGTTAATTGGCGATTCAGCTGTTGGGAAGTCAAATTTACTGGCCAGGT TCGCAAGAGACGAGTTCCACCCCAATTCGAAATCAACCATAGGGGTCGAGTTCCAAACTCAGAAGATCGATATCAACGGGAAGGAAGTGAAAGCGCAGAT TTGGGACACTGCAGGTCAGGAGCGGTTTAGAGCCGTTACATCTGCATATTACAGAGGTGCAGTTGGAGCCCTTGTGGTCTATGATATCAGTAGACGCCAA ACTTTCGAAAGCATTGGCCGGTGGCTTAATGAACTTCAGACTCACTCAGACATGAATGTGGTGACGATACTCGTGGGCAACAAGTCTGATCTCAAGCGAG AGAGGTTCCGACATCAGAAGGGAAATCTTTAG
AA sequence Show only first row Show all	>Lus10039051 pacid=23150692 polypeptide=Lus10039051 locus=Lus10039051.g ID=Lus10039051.BGIv1.0 annot-version=v1.0 MAFYAQEDKADDYLFKIVLIGDSAVGKSNLLARFARDEFHPNSKSTIGVEFQTQKIDINGKEVKAQIWDTAGQERFRAVTSAYYRGAVGALVVYDISRRQ TFESIGRWLNELQTHSDMNVVTILVGNKSDLKRERFRHQKGNL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G47520		AtRABA5a	RAB GTPase homolog A5A (.1)		Lus10039051 [exp]	0	1
AT5G47520		AtRABA5a	RAB GTPase homolog A5A (.1)		Lus10039052 [exp]	1.0	0.8170
AT1G60660		B5 #5, B5#5, AT...	ARABIDOPSIS CYTOCHROME B5-LIKE...		Lus10034972 [exp]	12.7	0.7498
AT1G11000		ATMLO4, MLO4	MILDEW RESISTANCE LOCUS O 4, S...		Lus10012698 [exp]	19.9	0.7152
AT5G15770		ATGNA1	glucose-6-phosphate acetyltran...		Lus10022713 [exp]	26.5	0.7843
AT3G01435			Expressed protein (.1)		Lus10022634 [exp]	29.9	0.7654
AT2G18290		EMB2783, APC10	EMBRYO DEFECTIVE 2783, anaphas...		Lus10028308 [exp]	34.3	0.7581
AT5G38970		ATBR6OX, CYP85A...	brassinosteroid-6-oxidase 1 (....		Lus10005075 [exp]	35.9	0.7903
AT4G01040			Glycosyl hydrolase superfamily...		Lus10029447 [exp]	46.4	0.7679
AT3G55000		TON1A	TONNEAU 1A, TONNEAU 1, tonneau...		Lus10001983 [exp]	49.5	0.7566
AT4G01040			Glycosyl hydrolase superfamily...		Lus10005946 [exp]	50.1	0.7270

Compare expression of checked genes

Lus10039051 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.