Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G47520 86 / 1e-22 AtRABA5a RAB GTPase homolog A5A (.1) AT3G07410 53 / 3e-10 AtRABA5b RAB GTPase homolog A5B (.1) AT2G31680 50 / 5e-09 AtRABA5d RAB GTPase homolog A5D (.1) AT2G43130 48 / 3e-08 ARA4, AtRab11F, AtRABA5c, Ara-4 ARABIDOPSIS RAB GTPASE HOMOLOG A5C, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G05810 48 / 4e-08 ARA, Ara-1, AtRab11D, AtRABA5e ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) AT5G47960 45 / 5e-07 SMG1, AtRABA4c SMALL MOLECULAR WEIGHT G-PROTEIN 1, RAB GTPase homolog A4C (.1) AT4G18430 45 / 5e-07 AtRABA1e RAB GTPase homolog A1E (.1) AT3G12160 44 / 8e-07 AtRABA4d ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) AT1G07410 43 / 2e-06 ATRAB-A2B, AtRABA2b ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) AT5G59150 43 / 2e-06 ATRAB-A2D, AtRABA2d ARABIDOPSIS RAB GTPASE HOMOLOG A2D, RAB GTPase homolog A2D (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000047 [exp] 140 / 6e-46 AT5G47520 86 / 1e-22 RAB GTPase homolog A5A (.1) Lus10038807 [exp] 130 / 4e-40 AT5G47520 376 / 2e-134 RAB GTPase homolog A5A (.1) Lus10000536 [exp] 98 / 3e-27 AT5G47520 369 / 3e-131 RAB GTPase homolog A5A (.1) Lus10017558 [exp] 98 / 4e-27 AT5G47520 367 / 1e-130 RAB GTPase homolog A5A (.1) Lus10026731 [exp] 51 / 3e-09 AT2G31680 381 / 2e-136 RAB GTPase homolog A5D (.1) Lus10025516 [exp] 51 / 3e-09 AT2G31680 381 / 2e-136 RAB GTPase homolog A5D (.1) Lus10038226 [exp] 49 / 2e-08 AT1G05810 333 / 3e-117 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) Lus10025876 [exp] 49 / 2e-08 AT1G05810 331 / 1e-116 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) Lus10021023 [exp] 47 / 1e-07 AT3G12160 384 / 3e-132 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G010300 [exp] 95 / 6e-26 AT5G47520 395 / 7e-142 RAB GTPase homolog A5A (.1) Potri.006G015400 [exp] 93 / 2e-25 AT5G47520 398 / 5e-143 RAB GTPase homolog A5A (.1) Potri.003G004100 [exp] 54 / 2e-10 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Potri.014G150300 [exp] 52 / 9e-10 AT2G31680 374 / 1e-133 RAB GTPase homolog A5D (.1) Potri.002G249500 [exp] 50 / 4e-09 AT1G05810 333 / 8e-117 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) Potri.002G231800 [exp] 49 / 1e-08 AT2G31680 374 / 1e-133 RAB GTPase homolog A5D (.1) Potri.006G057700 [exp] 46 / 2e-07 AT3G12160 387 / 1e-138 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Potri.006G000300 [exp] 44 / 1e-06 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.001G270100 [exp] 44 / 1e-06 AT3G12160 379 / 2e-135 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Potri.016G050400 [exp] 43 / 2e-06 AT3G12160 387 / 1e-138 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039052 pacid=23150633 polypeptide=Lus10039052 locus=Lus10039052.g ID=Lus10039052.BGIv1.0 annot-version=v1.0 ATGGAAACTTCTGCTCTCGACTCCTCTAACGTAGCATCAGCGTTCGAGACAGTTGTGAAGGAGATATACAACATATTGAGCAGAAAGGTGATATCCCAGG AGCTCAAGAAACAGGAAGCCCCTGAAATGGGGAACGGAAAGACAGTGGTTTTACACAGCGATGAGGATGGCCCTGATGCAGCTAAACAAGGTGGCGGATG TTGCTAA
AA sequence Show only first row Show all	>Lus10039052 pacid=23150633 polypeptide=Lus10039052 locus=Lus10039052.g ID=Lus10039052.BGIv1.0 annot-version=v1.0 METSALDSSNVASAFETVVKEIYNILSRKVISQELKKQEAPEMGNGKTVVLHSDEDGPDAAKQGGGCC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G47520		AtRABA5a	RAB GTPase homolog A5A (.1)		Lus10039052 [exp]	0	1
AT5G47520		AtRABA5a	RAB GTPase homolog A5A (.1)		Lus10039051 [exp]	1.0	0.8170
AT5G62280			Protein of unknown function (D...		Lus10031122 [exp]	5.7	0.8076
AT5G41050			Pollen Ole e 1 allergen and ex...		Lus10041541 [exp]	7.1	0.8051
AT5G47520		AtRABA5a	RAB GTPase homolog A5A (.1)		Lus10000047 [exp]	10.0	0.7493
AT1G04040			HAD superfamily, subfamily III...		Lus10023731 [exp]	11.2	0.7950
AT2G45320			unknown protein		Lus10030280 [exp]	19.0	0.7704
AT3G52440	DOF	AtDof3,5	Dof-type zinc finger DNA-bindi...		Lus10013586 [exp]	24.3	0.7585
AT1G67590			Remorin family protein (.1.2)		Lus10036996 [exp]	25.4	0.7619
AT4G01040			Glycosyl hydrolase superfamily...		Lus10005946 [exp]	25.8	0.7453
AT1G11000		ATMLO4, MLO4	MILDEW RESISTANCE LOCUS O 4, S...		Lus10012698 [exp]	27.9	0.6917

Compare expression of checked genes

Lus10039052 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.