Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16450 187 / 2e-63 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038803 [exp] 209 / 4e-72 AT4G16450 189 / 4e-64 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G016300 [exp] 193 / 9e-66 AT4G16450 185 / 2e-62 unknown protein Potri.016G009600 [exp] 181 / 5e-61 AT4G16450 172 / 3e-57 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10785 [flax] [poplar] NADH-u_ox-rdase NADH-ubiquinone oxidoreductase complex I, 21 kDa subunit
Representative CDS sequence Show only first row Show all	>Lus10039057 pacid=23150333 polypeptide=Lus10039057 locus=Lus10039057.g ID=Lus10039057.BGIv1.0 annot-version=v1.0 ATGAACACTGACATTACAGCATCGACGAAGCCGGAGTACCCAGTCATAGATCGGAATCCAGCATTCACGAAGGTCGTCGGAAACTTCAACACCTTGGATT ATCTTCGTTTCACCACCATCACCGGCGTCTCCGTCACCGTCGGCTACCTTTCAGGGATTAAGCCAGGGCTGAAAGGACCATCTATGGTGACTGGGGGATT AATTGGGTTGCTGGGTGGGTTCATGTACGCTTACCAGAACTCGGCTGGGCGACTCATGGGGTTCTTCCCTAACGAGGGCGAGGTTGCTTCTTACCAAAAG AGCGGTTACAAGAACTGA
AA sequence Show only first row Show all	>Lus10039057 pacid=23150333 polypeptide=Lus10039057 locus=Lus10039057.g ID=Lus10039057.BGIv1.0 annot-version=v1.0 MNTDITASTKPEYPVIDRNPAFTKVVGNFNTLDYLRFTTITGVSVTVGYLSGIKPGLKGPSMVTGGLIGLLGGFMYAYQNSAGRLMGFFPNEGEVASYQK SGYKN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G16450			unknown protein		Lus10039057 [exp]	0	1
AT1G60770			Tetratricopeptide repeat (TPR)...		Lus10029115 [exp]	1.0	0.9352
AT4G09320		NDPK1	Nucleoside diphosphate kinase ...		Lus10024286 [exp]	6.0	0.9305
AT1G76010			Alba DNA/RNA-binding protein (...		Lus10034549 [exp]	11.5	0.9224
AT5G59410			Rab5-interacting family protei...		Lus10016530 [exp]	16.1	0.9111
AT1G27435			unknown protein		Lus10032003 [exp]	20.0	0.8809
AT1G09590			Translation protein SH3-like f...		Lus10017232 [exp]	20.9	0.9166
AT1G52600			Peptidase S24/S26A/S26B/S26C f...		Lus10011491 [exp]	22.0	0.8688
AT3G49660		AtWDR5a	human WDR5 \(WD40 repeat\) hom...		Lus10039636 [exp]	22.6	0.9069
AT3G57150		ATNAP57, ATCBF5...	homologue of NAP57 (.1)		Lus10040451 [exp]	23.8	0.9073
AT2G44050		COS1	coronatine insensitive1 suppre...		Lus10028541 [exp]	27.7	0.8811

Compare expression of checked genes

Lus10039057 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.