Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G31420 40 / 0.0001 B3 Domain of unknown function (DUF313) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038802 [exp] 159 / 1e-49 AT3G24850 69 / 1e-13 Domain of unknown function (DUF313) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G014700 [exp] 45 / 2e-06 AT3G24850 75 / 8e-15 Domain of unknown function (DUF313) (.1) Potri.015G014200 [exp] 45 / 2e-06 AT3G24850 73 / 2e-14 Domain of unknown function (DUF313) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0405 [flax] [poplar] DNA_b-psBarrel PF03754 [flax] [poplar] DUF313 Domain of unknown function (DUF313)
Representative CDS sequence Show only first row Show all	>Lus10039058 pacid=23150467 polypeptide=Lus10039058 locus=Lus10039058.g ID=Lus10039058.BGIv1.0 annot-version=v1.0 ATGTGCAAAGGAGTGCTGACCAAGGAAGAGGAGGAATGGTTGGCGACGGCACGAGGGGAGAAGAAGGGGGTGCTTGGGCTGGAGGTGAAGATGGTGGATC CAGAGCTCAAGGTTAGAAAGATGATTTTGAAGCATTGGGGTATGAGGAAGCCGAACGGGCCAGTGAGCTCCATTTATTTGTTGGCAAAATACTGGAACGA CGTTGTTAAGGAGCATGGGTTTAAGGAAGAGGAAGTAGTTCAGCTGTGGGGGGTTCCGAATGGGAGAAGAGGTGCCTGGGAAGTTAGGGCTTGCATTGGT TCGGCTTGGGATGATAGAAACCGGTGCTTCTTCAGGTCGTGGAGCTTAGTTTCCTGCAAACAAGAGTATTGGGGTTTCGATTAG
AA sequence Show only first row Show all	>Lus10039058 pacid=23150467 polypeptide=Lus10039058 locus=Lus10039058.g ID=Lus10039058.BGIv1.0 annot-version=v1.0 MCKGVLTKEEEEWLATARGEKKGVLGLEVKMVDPELKVRKMILKHWGMRKPNGPVSSIYLLAKYWNDVVKEHGFKEEEVVQLWGVPNGRRGAWEVRACIG SAWDDRNRCFFRSWSLVSCKQEYWGFD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G31420	B3		Domain of unknown function (DU...		Lus10039058 [exp]	0	1
AT5G58170		GDPDL7, SVL5	Glycerophosphodiester phosphod...		Lus10040036 [exp]	1.0	0.9005
AT3G11770			Polynucleotidyl transferase, r...		Lus10010357 [exp]	3.2	0.8733
AT4G11070	WRKY	ATWRKY41, WRKY4...	WRKY family transcription fact...		Lus10003894 [exp]	4.2	0.8360
AT2G45910			U-box domain-containing protei...		Lus10018835 [exp]	5.5	0.8997
					Lus10007802 [exp]	7.7	0.8915
					Lus10023010 [exp]	9.2	0.8801
AT4G13450			Adenine nucleotide alpha hydro...		Lus10023716 [exp]	9.9	0.8634
AT3G28580			P-loop containing nucleoside t...		Lus10014497 [exp]	12.4	0.8603
AT5G24090		ATCHIA	chitinase A (.1)		Lus10040419 [exp]	12.6	0.8137
AT1G49170			Protein of unknown function (D...		Lus10042819 [exp]	12.6	0.8377

Compare expression of checked genes

Lus10039058 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.