Lus10039059 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G35740 157 / 3e-50 Carbohydrate-binding X8 domain superfamily protein (.1)
AT2G04910 129 / 1e-39 Carbohydrate-binding X8 domain superfamily protein (.1.2)
AT4G29360 100 / 2e-25 O-Glycosyl hydrolases family 17 protein (.1.2)
AT4G05430 94 / 5e-25 Carbohydrate-binding X8 domain superfamily protein (.1)
AT1G29380 97 / 9e-25 Carbohydrate-binding X8 domain superfamily protein (.1)
AT1G79480 97 / 2e-24 Carbohydrate-binding X8 domain superfamily protein (.1.2)
AT5G63240 91 / 3e-24 Carbohydrate-binding X8 domain superfamily protein (.1)
AT3G58100 92 / 5e-24 PDCB5 plasmodesmata callose-binding protein 5 (.1)
AT3G13560 96 / 2e-23 O-Glycosyl hydrolases family 17 protein (.1.2.3)
AT2G30933 90 / 8e-23 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038801 182 / 4e-60 AT5G35740 146 / 1e-46 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10012324 148 / 7e-47 AT5G35740 164 / 8e-54 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10001167 137 / 1e-42 AT5G35740 150 / 3e-48 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10001740 103 / 2e-29 AT5G35740 111 / 2e-33 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10039179 99 / 1e-24 AT3G13560 634 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2.3)
Lus10023276 94 / 1e-24 AT4G05430 146 / 3e-45 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10015151 98 / 2e-24 AT2G05790 731 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Lus10002466 94 / 2e-24 AT5G67460 175 / 1e-53 O-Glycosyl hydrolases family 17 protein (.1)
Lus10004600 95 / 7e-24 AT1G29380 168 / 7e-50 Carbohydrate-binding X8 domain superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G016800 167 / 2e-54 AT5G35740 156 / 1e-50 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.014G164600 152 / 2e-48 AT5G35740 179 / 8e-60 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.011G078500 98 / 4e-25 AT1G29380 154 / 1e-44 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.001G006500 98 / 2e-24 AT3G13560 632 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2.3)
Potri.001G353400 96 / 2e-24 AT1G29380 144 / 1e-40 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.003G218500 97 / 3e-24 AT3G13560 594 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2.3)
Potri.017G055700 92 / 8e-24 AT4G13600 152 / 3e-46 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.008G082900 95 / 1e-23 AT1G79480 159 / 3e-45 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Potri.002G059600 92 / 2e-23 AT2G30933 164 / 5e-50 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Potri.019G012000 89 / 7e-23 AT4G05430 155 / 3e-49 Carbohydrate-binding X8 domain superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07983 X8 X8 domain
Representative CDS sequence
>Lus10039059 pacid=23150458 polypeptide=Lus10039059 locus=Lus10039059.g ID=Lus10039059.BGIv1.0 annot-version=v1.0
ATGGAGAAACGTCCCTCGTTCCGCTCCAAATCTGTACGGAACAAGTGCTTTTGGATAATCAGTTTTATCTCTCTCCCGCAAAGTTCCTGCTGTATGTATT
CCACAAACGCGTGCGGAATCGTAGCGCTACTCTCGAGCTGCTCCGGACCCCCACGAAATGGGGAGCGATTGGCGGATGGAGGTTTCGAGGCGAAGGAATG
GTGCATAGCGGACGAGCAGACACCAGACGACGAGTTGCAGAATGCGCTAGATTGGGCGTGTGGGAAAGTGGGAGGTGCAGATTGCTCCAAGTTGCAGAAG
AAGCAGCCATGTTTCCTCCCCAACACCATAAGGGATCATGCCTCTTTTGCCTTCAACAGCTACTACCAGAGGTTTAAGAGGCAAGGGGCCACCTGTTACT
TCAATTCTGCTGCCATGGTCACCGACCTCGATCCAAGCCAAGGTTCATGCAAATATGACTACTTGCCTTGA
AA sequence
>Lus10039059 pacid=23150458 polypeptide=Lus10039059 locus=Lus10039059.g ID=Lus10039059.BGIv1.0 annot-version=v1.0
MEKRPSFRSKSVRNKCFWIISFISLPQSSCCMYSTNACGIVALLSSCSGPPRNGERLADGGFEAKEWCIADEQTPDDELQNALDWACGKVGGADCSKLQK
KQPCFLPNTIRDHASFAFNSYYQRFKRQGATCYFNSAAMVTDLDPSQGSCKYDYLP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G35740 Carbohydrate-binding X8 domain... Lus10039059 0 1
AT4G05220 Late embryogenesis abundant (L... Lus10006755 1.0 0.9550
AT1G10380 Putative membrane lipoprotein ... Lus10036687 3.7 0.9326
AT2G37925 COPT4 copper transporter 4 (.1) Lus10021108 4.5 0.9150
AT4G16790 hydroxyproline-rich glycoprote... Lus10004758 5.9 0.9090
AT1G68430 unknown protein Lus10034103 6.0 0.9111
AT2G27140 HSP20-like chaperones superfam... Lus10003356 9.0 0.9231
AT3G55370 DOF OBP3, AtDof3. 6 OBF-binding protein 3 (.1.2.3) Lus10016566 10.2 0.9012
AT1G62760 Plant invertase/pectin methyle... Lus10004327 10.4 0.8809
AT4G16640 Matrixin family protein (.1) Lus10004728 11.0 0.9050
AT1G75260 oxidoreductases, acting on NAD... Lus10001963 11.4 0.9131

Lus10039059 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.