Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09950 85 / 7e-23 unknown protein AT3G55570 75 / 8e-19 unknown protein AT5G55620 71 / 2e-17 unknown protein AT5G41761 71 / 3e-17 unknown protein AT3G11405 55 / 1e-10 unknown protein AT5G06010 51 / 1e-09 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038794 [exp] 167 / 2e-55 AT3G09950 82 / 6e-22 unknown protein Lus10012634 [exp] 76 / 3e-19 AT5G41761 85 / 6e-23 unknown protein Lus10000541 [exp] 75 / 8e-19 AT5G41761 96 / 2e-27 unknown protein Lus10017552 [exp] 74 / 5e-18 AT5G41761 94 / 2e-25 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G017700 [exp] 110 / 1e-32 AT5G41761 83 / 6e-22 unknown protein Potri.014G095000 [exp] 79 / 2e-20 AT5G41761 97 / 1e-27 unknown protein Potri.003G136700 [exp] 76 / 2e-19 AT5G41761 102 / 4e-30 unknown protein Potri.001G313801 [exp] 73 / 7e-18 AT3G55570 85 / 1e-22 unknown protein Potri.001G313700 [exp] 72 / 7e-18 AT3G55570 93 / 2e-26 unknown protein Potri.012G031900 [exp] 71 / 1e-17 AT5G41761 88 / 2e-24 unknown protein Potri.014G095100 [exp] 70 / 3e-17 AT5G41761 92 / 3e-26 unknown protein Potri.002G167900 [exp] 69 / 8e-17 AT5G41761 86 / 1e-23 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039065 pacid=23150470 polypeptide=Lus10039065 locus=Lus10039065.g ID=Lus10039065.BGIv1.0 annot-version=v1.0 ATGGCGGAATTGATGAAAGCCATTCTCCACTCGGCGTGCCATGTCATCGGCTACTCCAAAGACGAATCACCATCCCCCGCCGCCGCCGCCGGTTGCAAGA CAGCAGTAACGCCGCCGCCGCTGAAGCCGACGACAGCAGAGTTCAGGATGCCGCTTCATTACCCGAGGTACAGCAAGAAGGATTACGAAGGGATGGAAGA ATGGAGGCTGGATCTTCTCTTCTCGCAGTACGGTCTCCGTTTCGACGGCTCTCTGGCTGAGAAGCGCGCTTACGCCATTGGAACCTTCCTCTGGCCTGAC CAGTATTGA
AA sequence Show only first row Show all	>Lus10039065 pacid=23150470 polypeptide=Lus10039065 locus=Lus10039065.g ID=Lus10039065.BGIv1.0 annot-version=v1.0 MAELMKAILHSACHVIGYSKDESPSPAAAAGCKTAVTPPPLKPTTAEFRMPLHYPRYSKKDYEGMEEWRLDLLFSQYGLRFDGSLAEKRAYAIGTFLWPD QY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G09950			unknown protein		Lus10039065 [exp]	0	1
AT1G12600			UDP-N-acetylglucosamine (UAA) ...		Lus10015850 [exp]	5.6	0.8855
AT3G54320	AP2_ERF	ATWRI1, ASML1, ...	WRINKLED 1, WRINKLED, ACTIVATO...		Lus10036719 [exp]	6.5	0.9057
AT3G47830			DNA glycosylase superfamily pr...		Lus10034120 [exp]	7.4	0.8670
AT3G10920		MSD1, MEE33, AT...	MATERNAL EFFECT EMBRYO ARREST ...		Lus10030534 [exp]	9.4	0.9309
AT5G27870			Plant invertase/pectin methyle...		Lus10020313 [exp]	12.0	0.8334
AT3G05550			Hypoxia-responsive family prot...		Lus10033002 [exp]	13.3	0.9169
					Lus10003860 [exp]	14.3	0.9064
AT5G25940			early nodulin-related (.1)		Lus10030052 [exp]	14.8	0.9226
					Lus10003802 [exp]	17.2	0.9161
AT5G56970		ATCKX3, CKX3	cytokinin oxidase 3 (.1)		Lus10031188 [exp]	18.5	0.9099

Compare expression of checked genes

Lus10039065 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.