Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G15395 83 / 2e-23 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027849 [exp] 111 / 2e-34 AT3G15395 83 / 2e-23 unknown protein Lus10038792 [exp] 107 / 4e-33 AT3G15395 80 / 3e-22 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G402000 [exp] 83 / 2e-23 AT3G15395 79 / 1e-21 unknown protein Potri.006G225232 [exp] 64 / 1e-15 AT3G15395 58 / 3e-13 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039067 pacid=23150302 polypeptide=Lus10039067 locus=Lus10039067.g ID=Lus10039067.BGIv1.0 annot-version=v1.0 ATGGGAGGCCGTGGTGTTATAGGTGATAAATGGTCCATGAGAATTCTCTGGCTGTGTGCTATAGGAAGTGCAGCAGGTCTGTACATGGTTGCAGTTGAAA GACAAGCACAAAACAGACAGCGGATGATGGCTGAAGCTTTAATGAGCCTGGATGAAGATGGAGACGATGTTTAG
AA sequence Show only first row Show all	>Lus10039067 pacid=23150302 polypeptide=Lus10039067 locus=Lus10039067.g ID=Lus10039067.BGIv1.0 annot-version=v1.0 MGGRGVIGDKWSMRILWLCAIGSAAGLYMVAVERQAQNRQRMMAEALMSLDEDGDDV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G15395			unknown protein		Lus10039067 [exp]	0	1
AT2G37120			S1FA-like DNA-binding protein ...		Lus10015073 [exp]	1.0	0.8313
AT2G41600			Mitochondrial glycoprotein fam...		Lus10042041 [exp]	1.4	0.7616
AT1G73177		APC13, BNS	anaphase-promoting complex 13,...		Lus10029234 [exp]	2.8	0.7585
AT3G02950		AtTHO7	Tho complex subunit 7/Mft1p (....		Lus10012882 [exp]	3.0	0.7600
AT2G21290			unknown protein		Lus10018053 [exp]	11.8	0.7474
					Lus10030382 [exp]	13.8	0.7202
AT3G03580			Tetratricopeptide repeat (TPR)...		Lus10004744 [exp]	14.0	0.7136
AT5G61310			Cytochrome c oxidase subunit V...		Lus10040012 [exp]	15.0	0.7074
AT2G33370			Ribosomal protein L14p/L23e fa...		Lus10042695 [exp]	16.3	0.7167
AT2G32520			alpha/beta-Hydrolases superfam...		Lus10035287 [exp]	16.3	0.7231

Compare expression of checked genes

Lus10039067 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.